Orc2 Antibody

Images

 
Western Blot: Orc2 Antibody [NBP2-56503] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Orc2 Antibody [NBP2-56503] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Orc2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK
Specificity
Specificity of human Orc2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORC2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
Orc2 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Orc2 Antibody

  • ORC2Lorigin recognition complex subunit 2
  • origin recognition complex protein 2 homolog
  • origin recognition complex, subunit 2 (yeast homolog)-like
  • origin recognition complex, subunit 2 homolog (yeast)
  • origin recognition complex, subunit 2 homolog
  • origin recognition complex, subunit 2
  • origin recognition complex, subunit 2-like (yeast)
  • origin recognition complex, subunit 2-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46192
Species: Hu
Applications: WB, IHC
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-55408
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-75569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49097
Species: Hu
Applications: IHC, IHC-P
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-67897
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52420
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Orc2 Antibody (NBP2-56503) (0)

There are no publications for Orc2 Antibody (NBP2-56503).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Orc2 Antibody (NBP2-56503) (0)

There are no reviews for Orc2 Antibody (NBP2-56503). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Orc2 Antibody (NBP2-56503) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Orc2 Products

Bioinformatics Tool for Orc2 Antibody (NBP2-56503)

Discover related pathways, diseases and genes to Orc2 Antibody (NBP2-56503). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Orc2 Antibody (NBP2-56503)

Discover more about diseases related to Orc2 Antibody (NBP2-56503).
 

Pathways for Orc2 Antibody (NBP2-56503)

View related products by pathway.

PTMs for Orc2 Antibody (NBP2-56503)

Learn more about PTMs related to Orc2 Antibody (NBP2-56503).
 

Research Areas for Orc2 Antibody (NBP2-56503)

Find related products by research area.

Blogs on Orc2

There are no specific blogs for Orc2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Orc2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC2