OPLAH Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OPLAH Antibody [NBP2-57057] - Staining of human cell line PC-3 shows localization to nucleoli fibrillar center.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OPLAH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEVFGNLNA
Specificity
Specificity of human OPLAH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OPLAH
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OPLAH Recombinant Protein Antigen (NBP2-57057PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75513
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-56928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001497-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-54724
Species: Hu
Applications: WB, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-57057
Species: Hu, Rt
Applications: ICC/IF

Publications for OPLAH Antibody (NBP2-57057) (0)

There are no publications for OPLAH Antibody (NBP2-57057).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OPLAH Antibody (NBP2-57057) (0)

There are no reviews for OPLAH Antibody (NBP2-57057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OPLAH Antibody (NBP2-57057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OPLAH Products

Array NBP2-57057

Bioinformatics Tool for OPLAH Antibody (NBP2-57057)

Discover related pathways, diseases and genes to OPLAH Antibody (NBP2-57057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OPLAH Antibody (NBP2-57057)

Discover more about diseases related to OPLAH Antibody (NBP2-57057).

Blogs on OPLAH

There are no specific blogs for OPLAH, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OPLAH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPLAH