Olig2 Recombinant Protein Antigen

Images

 
There are currently no images for Olig2 Protein (NBP1-88634PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Olig2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OLIG2.

Source: E. coli

Amino Acid Sequence: SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OLIG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88634.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Olig2 Recombinant Protein Antigen

  • BHLHB1
  • BHLHE19
  • Class B basic helix-loop-helix protein 1
  • Class E basic helix-loop-helix protein 19
  • human protein kinase C-binding protein RACK17
  • Olig2
  • OLIGO2
  • oligodendrocyte lineage transcription factor 2
  • oligodendrocyte transcription factor 2
  • oligodendrocyte-specific bHLH transcription factor 2
  • PRKCBP2
  • protein kinase C binding protein 2
  • Protein kinase C-binding protein 2
  • Protein kinase C-binding protein RACK17
  • RACK17
  • RACK17helix-loop-helix protein, class B, 1

Background

Olig2 is a transcription factor which is required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. OIlig2 is expressed in the ventral spinal cord as early as 9.5 dpc and is scattered in the mantle zone, likely corresponding to oligodendrocyte progenitors migrating out from their site of origin. (Arnett et al., 2004) From 10.5 through 14.5 dpc, Olig2 is expressed in numerous cells in the ventricular and subventricular zones of the lateral and medial ganglionic eminences, suggesting that expression might not be limited to the oligodendrocytic lineage. Olig2 has further been shown to be critical in the proliferation of malignant glioma in brain tumors (Ligon et al., 2007).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB2417
Species: Hu
Applications: IHC, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NB100-2688
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, WB
AF2567
Species: Mu
Applications: IHC, WB
NBP1-82554
Species: Fe, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KO, WB
NBP2-94913
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF2864
Species: Hu
Applications: ICC, IHC, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
233-FB
Species: Hu
Applications: BA
NB100-74503
Species: Mu, Rt
Applications: ICC/IF, WB
MAB3314
Species: Hu, Rt
Applications: IHC
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
NBP1-49672
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88634PEP
Species: Hu
Applications: AC

Publications for Olig2 Protein (NBP1-88634PEP) (0)

There are no publications for Olig2 Protein (NBP1-88634PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olig2 Protein (NBP1-88634PEP) (0)

There are no reviews for Olig2 Protein (NBP1-88634PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Olig2 Protein (NBP1-88634PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Olig2 Products

Research Areas for Olig2 Protein (NBP1-88634PEP)

Find related products by research area.

Blogs on Olig2

There are no specific blogs for Olig2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Olig2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OLIG2