Olig1 Antibody (2B11)

Images

 
Western Blot: Olig1 Antibody (2B11) [H00116448-M04] - Analysis of OLIG1 transfected lysate using anti-OLIG1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OLIG1 rabbit polyclonal antibody.
Immunocytochemistry/ Immunofluorescence: Olig1 Antibody (2B11) [H00116448-M04] - Analysis of monoclonal antibody to OLIG1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
2B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Olig1 Antibody (2B11) Summary

Immunogen
OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL
Specificity
OLIG1 (2B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OLIG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Olig1 Antibody (2B11)

  • BHLHB6
  • bHLHe21
  • Class B basic helix-loop-helix protein 6
  • Class E basic helix-loop-helix protein 21
  • helix-loop-helix protein, class B, 6
  • Olig1
  • oligo1
  • oligodendrocyte lineage transcription factor 1
  • oligodendrocyte transcription factor 1
  • oligodendrocyte-specific bHLH transcription factor 1

Background

Olig genes have been identified as the earliest known markers of oligodendrocyte lineage determination to date (Zhou et al., 2000). Olig1 is a transcription factor which promotes formation and maturation of oligodendrocytes, especially within the brain. It is expressed in the ventral spinal cord as early as 9.5 dpc and by 15.5 dpc, olig1 is dispersed throughout the gray matter. In the postnatal brain, it is present preferentially in the white matter, such as corpus callosum and cerebellar medulla. Olig1 has been demonstrated as necessary in the repair of brain lesions in patients with multiple sclerosis (Arnett et al. 2004).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2418
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
1845-SH/CF
Species: Hu
Applications: BA
NB100-2688
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
AF2864
Species: Hu
Applications: ICC, IHC, WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-82554
Species: Fe, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-94913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2567
Species: Mu
Applications: IHC, WB
538-MG
Species: Rt
Applications: BA
H00004340-B01P
Species: Hu, Rt
Applications: WB
233-FB/CF
Species: Hu
Applications: BA
MAB7650
Species: Mu
Applications: IHC, WB
AF1062
Species: Mu
Applications: IHC, Neut, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-47871
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00116448-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for Olig1 Antibody (H00116448-M04) (0)

There are no publications for Olig1 Antibody (H00116448-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olig1 Antibody (H00116448-M04) (0)

There are no reviews for Olig1 Antibody (H00116448-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Olig1 Antibody (H00116448-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Olig1 Products

Bioinformatics Tool for Olig1 Antibody (H00116448-M04)

Discover related pathways, diseases and genes to Olig1 Antibody (H00116448-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Olig1 Antibody (H00116448-M04)

Discover more about diseases related to Olig1 Antibody (H00116448-M04).
 

Pathways for Olig1 Antibody (H00116448-M04)

View related products by pathway.

PTMs for Olig1 Antibody (H00116448-M04)

Learn more about PTMs related to Olig1 Antibody (H00116448-M04).
 

Research Areas for Olig1 Antibody (H00116448-M04)

Find related products by research area.

Blogs on Olig1

There are no specific blogs for Olig1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Olig1 Antibody (2B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol OLIG1
Entrez
OMIM
Uniprot