Olig1 Antibody (2B11) - Azide and BSA Free Summary
Immunogen |
OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL |
Specificity |
OLIG1 (2B11) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
OLIG1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunoprecipitation
- Western Blot 1:500
|
Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Olig1 Antibody (2B11) - Azide and BSA Free
Background
Olig genes have been identified as the earliest known markers of oligodendrocyte lineage determination to date (Zhou et al., 2000). Olig1 is a transcription factor which promotes formation and maturation of oligodendrocytes, especially within the brain. It is expressed in the ventral spinal cord as early as 9.5 dpc and by 15.5 dpc, olig1 is dispersed throughout the gray matter. In the postnatal brain, it is present preferentially in the white matter, such as corpus callosum and cerebellar medulla. Olig1 has been demonstrated as necessary in the repair of brain lesions in patients with multiple sclerosis (Arnett et al. 2004).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ICC, IHC, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Mu
Applications: BA
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Fe, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Rt
Applications: BA
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Publications for Olig1 Antibody (H00116448-M04) (0)
There are no publications for Olig1 Antibody (H00116448-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Olig1 Antibody (H00116448-M04) (0)
There are no reviews for Olig1 Antibody (H00116448-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Olig1 Antibody (H00116448-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Olig1 Products
Research Areas for Olig1 Antibody (H00116448-M04)
Find related products by research area.
|
Blogs on Olig1