Ocular development associated gene Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Ocular development associated gene Antibody [NBP2-57351] - Staining of human cell line SK-MEL-30 shows localization to nucleus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ocular development associated gene Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR
Specificity
Specificity of human Ocular development associated gene antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GATAD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ocular development associated gene Recombinant Protein Antigen (NBP2-57351PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ocular development associated gene Antibody

  • FLJ22489
  • GATA zinc finger domain containing 1
  • GATA zinc finger domain-containing protein 1
  • ocular development associated
  • Ocular development-associated gene protein
  • ODAGFLJ40695
  • RG083M05.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-91874
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59875
Species: Hu
Applications: WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-20235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89726
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Ocular development associated gene Antibody (NBP2-57351) (0)

There are no publications for Ocular development associated gene Antibody (NBP2-57351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ocular development associated gene Antibody (NBP2-57351) (0)

There are no reviews for Ocular development associated gene Antibody (NBP2-57351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ocular development associated gene Antibody (NBP2-57351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ocular development associated gene Products

Bioinformatics Tool for Ocular development associated gene Antibody (NBP2-57351)

Discover related pathways, diseases and genes to Ocular development associated gene Antibody (NBP2-57351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ocular development associated gene Antibody (NBP2-57351)

Discover more about diseases related to Ocular development associated gene Antibody (NBP2-57351).
 

Pathways for Ocular development associated gene Antibody (NBP2-57351)

View related products by pathway.

Research Areas for Ocular development associated gene Antibody (NBP2-57351)

Find related products by research area.

Blogs on Ocular development associated gene

There are no specific blogs for Ocular development associated gene, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ocular development associated gene Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GATAD1