PFTK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PFTK1 Antibody [NBP1-80920] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PFTK1 Antibody [NBP1-80920] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PFTK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
Specificity
Specificity of human PFTK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PFTK1 Protein (NBP1-80920PEP)
Publications
Read Publication using NBP1-80920.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22333595)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PFTK1 Antibody

  • Cell division protein kinase 14
  • cyclin-dependent kinase 14
  • EC 2.7.11
  • KIAA0834EC 2.7.11.22
  • PFTAIRE1hPFTAIRE1
  • PFTK1PFTAIRE protein kinase 1
  • Serine/threonine-protein kinase PFTAIRE-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88542
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-95244
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79800
Species: Hu
Applications: WB
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-14908
Species: Hu
Applications: WB, ICC/IF
NBP2-67811
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46218
Species: Hu
Applications: WB, IHC
MAB6570
Species: Hu
Applications: WB, IHC
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP1-92219
Species: Hu
Applications: WB, ICC/IF
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-92924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80577
Species: Hu
Applications: WB, ICC/IF
NBP2-00532
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for PFTK1 Antibody (NBP1-80920)(1)

Reviews for PFTK1 Antibody (NBP1-80920) (0)

There are no reviews for PFTK1 Antibody (NBP1-80920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PFTK1 Antibody (NBP1-80920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PFTK1 Products

Bioinformatics Tool for PFTK1 Antibody (NBP1-80920)

Discover related pathways, diseases and genes to PFTK1 Antibody (NBP1-80920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PFTK1 Antibody (NBP1-80920)

Discover more about diseases related to PFTK1 Antibody (NBP1-80920).
 

Pathways for PFTK1 Antibody (NBP1-80920)

View related products by pathway.

PTMs for PFTK1 Antibody (NBP1-80920)

Learn more about PTMs related to PFTK1 Antibody (NBP1-80920).
 

Research Areas for PFTK1 Antibody (NBP1-80920)

Find related products by research area.

Blogs on PFTK1

There are no specific blogs for PFTK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PFTK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK14
Entrez