Home » SLC10A7 » SLC10A7 Antibodies » SLC10A7 Antibody

SLC10A7 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry: SLC10A7 Antibody [NBP1-86784] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry: SLC10A7 Antibody [NBP1-86784] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SLC10A7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL
Specificity
Specificity of human SLC10A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC10A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC10A7 Protein (NBP1-86784PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC10A7 Antibody

  • C4orf13
  • chromosome 4 open reading frame 13
  • DKFZp313H0531
  • DKFZp566M114
  • DKFZp779O2438
  • MGC25043
  • Na(+)/bile acid cotransporter 7
  • P7
  • SBF-domain containing protein
  • sodium/bile acid cotransporter 7
  • solute carrier family 10 (sodium/bile acid cotransporter family), member 7
  • Solute carrier family 10 member 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - Analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - Analysis of FFPE mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Exosome Component
9 Antibody
NBP1-71702
Western Blot: Exosome Component 9 Antibody [NBP1-71702] - Analysis of EXOSC9 in A. HepG2 cell lysate and B. MCF7 cell lysate.
Immunocytochemistry/Immunofluorescence: Exosome Component 9 Antibody [NBP1-71702] - EXOSC9 antibody was tested at 1:100 in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).
Immunohistochemistry: Exosome Component 9 Antibody [NBP1-71702] - Staining of EXOSC9 in mouse prostate.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
S100A9 Antibody
[Unconjugated]
AF2065
Western blot shows lysate of mouse lung tissue. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A9 at approximately 14 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
S100A9 was detected in immersion fixed XB2 mouse teratoma keratinocyte cell line using 10 µg/mL Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counte­rstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
S100A9 was detected in perfusion fixed frozen sections of mouse spleen using Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) at 0.3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in splenocytes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(18 Publications)
Species: Mu
Applications: WB, Simple Western, IHC, ICC
SF3B14 Antibody
NBP1-87431
Western Blot: SF3B14 Antibody [NBP1-87431] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: SF3B14 Antibody [NBP1-87431] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87431] - Staining of human lymph node.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
RPP14 Antibody
NBP1-80965
Western Blot: RPP14 Antibody [NBP1-80965] - Analysis in control (vector only transfected HEK293T lysate) and RPP14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: RPP14 Antibody [NBP1-80965] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RPP14 Antibody [NBP1-80965] - Staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDK2AP2 Antibody
NBP1-91776
Western Blot: CDK2AP2 Antibody [NBP1-91776] - Analysis in control (vector only transfected HEK293T lysate) and CDK2AP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: CDK2AP2 Antibody [NBP1-91776] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CDK2AP2 Antibody [NBP1-91776] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ROBLD3 Antibody
NBP1-71687
Immunocytochemistry/Immunofluorescence: ROBLD3 Antibody [NBP1-71687] - ROBLD3 Antibody was tested at 1:100 in NIH/3T3 cells with FITC (green). Nuclei (Blue) were counterstained with DAPI (blue).
Immunohistochemistry: ROBLD3 Antibody [NBP1-71687] - Analysis of ROBLD3 in human renal cell carcinoma.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
CD77 Synthase
Antibody
NBP2-57614
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP2-57614] - Staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
Recombinant Human
B3GALNT1 Protein
H00008706-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
NUCKS1 Antibody
NB100-74635
Western Blot: NUCKS1 Antibody [NB100-74635] - Detection of Human NUCKS by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-NUCKS antibody NB100-74635 used for IP at 3 mcg/mg lysate. NUCKS was also immunoprecipitated by rabbit anti-NUCKS antibody NB100-74634, which recognizes an upstream epitope. Detection: Chemiluminescence with an exposure time of 30 seconds
Immunohistochemistry: NUCKS1 Antibody [NB100-74635] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- NUCKS used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P
Perforin Antibody
(CB5.4)
NBP1-97512
Western Blot: Perforin Antibody (CB5.4) [NBP1-97512] - Detection of perforin in the mouse T cell clone B6.1. (lane 1). Absence of perforin in the mouse fibroblast cell line NIH.3T3 (lane 2). The protein migrates as a 66 kDa species. Method: Cell extracts from the T cell clone B6.1 (2x10^6) were resolved by SDS-PAGE under reducing conditions, transferred to nitrocellulose and probed with the CB5.4 antibody at 1 ug/ml. Proteins were visualized using a peroxidase-conjugated antibody to rat IgG and a chemiluminescence detection system.
(5 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
RPLP1 Antibody
NBP1-81293
Western Blot: RPLP1 Antibody [NBP1-81293] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: RPLP1 Antibody [NBP1-81293] - Staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
SLC10A3 Antibody
NBP1-84957
Western Blot: SLC10A3 Antibody [NBP1-84957] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-529
Immunohistochemistry-Paraffin: SLC10A3 Antibody [NBP1-84957] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
ATP5G3 Knockout
293T Cell Lysate
NBP2-65538
ATP5G3 Knockout 293T Cell Lysate
Species: Hu
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC

Publications for SLC10A7 Antibody (NBP1-86784) (0)

There are no publications for SLC10A7 Antibody (NBP1-86784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC10A7 Antibody (NBP1-86784) (0)

There are no reviews for SLC10A7 Antibody (NBP1-86784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC10A7 Antibody (NBP1-86784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC10A7 Antibody (NBP1-86784)

Discover related pathways, diseases and genes to SLC10A7 Antibody (NBP1-86784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC10A7 Antibody (NBP1-86784)

Discover more about diseases related to SLC10A7 Antibody (NBP1-86784).
 

Pathways for SLC10A7 Antibody (NBP1-86784)

View related products by pathway.

Blogs on SLC10A7

There are no specific blogs for SLC10A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC10A7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC10A7