OBFC2A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OBFC2A Antibody [NBP2-58805] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OBFC2A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK
Specificity
Specificity of human OBFC2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NABP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OBFC2A Recombinant Protein Antigen (NBP2-58805PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for OBFC2A Antibody

  • DKFZp667M1322
  • FLJ13624
  • FLJ22833
  • hSSB2
  • MGC111163
  • oligonucleotide/oligosaccharide-binding fold containing 2A
  • Oligonucleotide/oligosaccharide-binding fold-containing protein 2A
  • Sensor of single-strand DNA complex subunit B2
  • Sensor of ssDNA subunit B2
  • SOSS complex subunit B2
  • SOSS-B2
  • SSB2Single-stranded DNA-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBL1-16438
Species: Hu
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-86998
Species: Hu
Applications: IHC, IHC-P, IP
H00023635-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-13376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for OBFC2A Antibody (NBP2-58805) (0)

There are no publications for OBFC2A Antibody (NBP2-58805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OBFC2A Antibody (NBP2-58805) (0)

There are no reviews for OBFC2A Antibody (NBP2-58805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OBFC2A Antibody (NBP2-58805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for OBFC2A Antibody (NBP2-58805)

Discover related pathways, diseases and genes to OBFC2A Antibody (NBP2-58805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OBFC2A

There are no specific blogs for OBFC2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OBFC2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NABP1