OASIS/CREB3L1 Antibody - BSA Free

Staining of human cell line U-251MG shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OASIS/CREB3L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OASIS/CREB3L1 Antibody - BSA Free (NBP3-25027) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein OASIS/CREB3L1 using the following amino acid sequence: MATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREB3L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OASIS/CREB3L1 Antibody - BSA Free

• BBF-2 Homolog
• cAMP responsive element binding protein 3-like 1
• cAMP-responsive element-binding protein 3-like protein 1
• CREB3L1
• OASIS
• OASIScyclic AMP-responsive element-binding protein 3-like protein 1
• old astrocyte specifically induced substance
• Old astrocyte specifically-induced substance

Background

Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein responsetarget genes. Specifically involved in ER-stress response in astrocytes in the central nervous system (Bysimilartity). May play a role in gliosis. In vitro, binds to box-B element, cAMP response element (CRE) and CRE-likesequences, and activates transcription through box-B element but not through CRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CREB3L1