NXF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NXF1 Antibody [NBP2-49341] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP2-49341] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NXF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
Specificity
Specificity of human NXF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NXF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NXF1 Recombinant Protein Antigen (NBP2-49341PEP)

Reactivity Notes

Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NXF1 Antibody

  • DKFZp667O0311
  • Mex67
  • mRNA export factor TAP
  • nuclear RNA export factor 1
  • TAPMEX67
  • tip associating protein
  • Tip-associated protein
  • Tip-associating protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45000
Species: Hu
Applications: Flow, PAGE, IF
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, IHC-P (-)

Publications for NXF1 Antibody (NBP2-49341) (0)

There are no publications for NXF1 Antibody (NBP2-49341).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NXF1 Antibody (NBP2-49341) (0)

There are no reviews for NXF1 Antibody (NBP2-49341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NXF1 Antibody (NBP2-49341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NXF1 Antibody (NBP2-49341)

Discover related pathways, diseases and genes to NXF1 Antibody (NBP2-49341). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NXF1 Antibody (NBP2-49341)

Discover more about diseases related to NXF1 Antibody (NBP2-49341).
 

Pathways for NXF1 Antibody (NBP2-49341)

View related products by pathway.

PTMs for NXF1 Antibody (NBP2-49341)

Learn more about PTMs related to NXF1 Antibody (NBP2-49341).

Blogs on NXF1

There are no specific blogs for NXF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NXF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NXF1