NUSAP1 Antibody - Azide and BSA Free

Western Blot: NUSAP1 Antibody [NBP3-04757] - Analysis of extracts of various cell lines, using NUSAP1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NUSAP1 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human NUSAP1 (NP_060924.4). MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUSAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NUSAP1 Antibody - Azide and BSA Free

• ANKTNUSAP
• BM037
• FLJ13421
• LNP
• nucleolar and spindle associated protein 1
• nucleolar and spindle-associated protein 1
• nucleolar protein ANKT
• NuSAP
• NuSAP1
• PRO0310p1
• Q0310
• SAPL

Background

NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 (PubMed 12963707)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NUSAP1