NUDT21 Antibody - BSA Free

Immunohistochemistry: NUDT21 Antibody [NBP3-38098] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using NUDT21 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: NUDT21 Antibody [NBP3-38098] - Western blot analysis of various lysates using NUDT21 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDT21 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDT21 Antibody - BSA Free (NBP3-38098) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human NUDT21 (NP_008937.1).
  
  Sequence:
  MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT21
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NUDT21 Antibody - BSA Free

• CFIm25
• CFIM25CPSF 25 kDa subunit
• cleavage and polyadenylation specific factor 5, 25 kD subunit
• cleavage and polyadenylation specific factor 5, 25 kDa
• Cleavage and polyadenylation specificity factor 25 kDa subunit
• cleavage and polyadenylation specificity factor subunit 5
• CPSF25
• CPSF5DKFZp686H1588
• Nucleoside diphosphate-linked moiety X motif 21
• nudix (nucleoside diphosphate linked moiety X)-type motif 21
• Nudix motif 21
• pre-mRNA cleavage factor Im (25kD)
• Pre-mRNA cleavage factor Im 25 kDa subunit
• pre-mRNA cleavage factor Im, 25kD subunit

Background

NUDT21 is encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDT21