NUDT21 Antibody - BSA Free

Immunohistochemistry: NUDT21 Antibody [NBP2-13682] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDT21 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDT21 Antibody - BSA Free (NBP2-13682) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLP
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT21
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NUDT21 Protein (NBP2-13682PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NUDT21 Antibody - BSA Free

• CFIm25
• CFIM25CPSF 25 kDa subunit
• cleavage and polyadenylation specific factor 5, 25 kD subunit
• cleavage and polyadenylation specific factor 5, 25 kDa
• Cleavage and polyadenylation specificity factor 25 kDa subunit
• cleavage and polyadenylation specificity factor subunit 5
• CPSF25
• CPSF5DKFZp686H1588
• Nucleoside diphosphate-linked moiety X motif 21
• nudix (nucleoside diphosphate linked moiety X)-type motif 21
• Nudix motif 21
• pre-mRNA cleavage factor Im (25kD)
• Pre-mRNA cleavage factor Im 25 kDa subunit
• pre-mRNA cleavage factor Im, 25kD subunit

Background

NUDT21 is encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDT21