NUDCD3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82940] - Staining of human cerebral cortex, liver, lymph node and skin using Anti-NUDCD3 antibody NBP1-82940 (A) shows similar protein distribution across tissues to independent antibody NBP1-82939 (B).

Western Blot: NUDCD3 Antibody [NBP1-82940] - Analysis in control (vector only transfected HEK293T lysate) and NUDCD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82940] - sSaining of human lymph node using Anti-NUDCD3 antibody.

Western Blot: NUDCD3 Antibody [NBP1-82940] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82940] - Staining of human skin.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82940] - Staining of human liver.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82940] - Staining of human cerebral cortex.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDCD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDCD3 Antibody - BSA Free (NBP1-82940) is a polyclonal antibody validated for use in IHC and WB. Anti-NUDCD3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKVGEYWWNAILEGEEPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQRFDPAMF
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDCD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NUDCD3 Protein (NBP1-82940PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NUDCD3 Antibody - BSA Free

• KIAA1068NudCL
• NudC domain containing 3
• nudC domain-containing protein 3
• NudC-like protein

Background

The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUDCD3 Antibody (NBP1-82940)(1)

Publication using NBP1-82940

• Chagraoui J, Girard S, Spinella JF, et al. UM171 Preserves Epigenetic Marks that Are Reduced in Ex Vivo Culture of Human HSCs via Potentiation of the CLR3-KBTBD4 Complex Cell stem cell 2021-01-07 [PMID: 33417871] (WB)

Bioinformatics

• Gene Symbol: NUDCD3