NUDCD3 Antibody

Images

 
Western Blot: NUDCD3 Antibody [NBP1-82940] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82940] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDCD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKVGEYWWNAILEGEEPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSPFRGQRFDPAMF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDCD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUDCD3 Protein (NBP1-82940PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUDCD3 Antibody

  • KIAA1068NudCL
  • NudC domain containing 3
  • nudC domain-containing protein 3
  • NudC-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89517
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF-252-PB
Species: Hu
Applications: WB
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-55339
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47266
Species: Hu, Mu
Applications: WB, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-15164
Species: Hu
Applications: WB, ICC/IF
NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89614
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00057118-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF875
Species: Hu
Applications: WB, IHC
NBP1-85539
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUDCD3 Antibody (NBP1-82940) (0)

There are no publications for NUDCD3 Antibody (NBP1-82940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDCD3 Antibody (NBP1-82940) (0)

There are no reviews for NUDCD3 Antibody (NBP1-82940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDCD3 Antibody (NBP1-82940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUDCD3 Products

Bioinformatics Tool for NUDCD3 Antibody (NBP1-82940)

Discover related pathways, diseases and genes to NUDCD3 Antibody (NBP1-82940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NUDCD3 Antibody (NBP1-82940)

View related products by pathway.

PTMs for NUDCD3 Antibody (NBP1-82940)

Learn more about PTMs related to NUDCD3 Antibody (NBP1-82940).

Blogs on NUDCD3

There are no specific blogs for NUDCD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDCD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDCD3