PSD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PSD3 Antibody [NBP2-55678] - Staining of human cell line A-431 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PSD3 Antibody [NBP2-55678] - Staining in human cerebral cortex and pancreas tissues using anti-PSD3 antibody. Corresponding PSD3 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: PSD3 Antibody [NBP2-55678] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PSD3 Antibody [NBP2-55678] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PSD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQ
Specificity
Specificity of human PSD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PSD3 Antibody

  • ADP-ribosylation factor guanine nucleotide factor 6
  • DKFZp761K1423
  • EFA6RHepatocellular carcinoma-associated antigen 67
  • Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6
  • HCA67Pleckstrin homology and SEC7 domain-containing protein 3
  • KIAA0942
  • PH and SEC7 domain-containing protein 3
  • pleckstrin and Sec7 domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30589
Species: Hu
Applications: IHC, IHC-P
H00005662-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90174
Species: Hu
Applications: IHC, IHC-P
H00084249-P01
Species: Hu
NBP2-42526
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA, S-ELISA, ELISA(Cap), ELISA(Det)
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-48656
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4524
Species: Rt
Applications: WB
NBP1-84006
Species: Hu
Applications: IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90106
Species: Hu
Applications: WB, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19939
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-55678
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PSD3 Antibody (NBP2-55678) (0)

There are no publications for PSD3 Antibody (NBP2-55678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSD3 Antibody (NBP2-55678) (0)

There are no reviews for PSD3 Antibody (NBP2-55678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PSD3 Antibody (NBP2-55678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PSD3 Products

Bioinformatics Tool for PSD3 Antibody (NBP2-55678)

Discover related pathways, diseases and genes to PSD3 Antibody (NBP2-55678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSD3 Antibody (NBP2-55678)

Discover more about diseases related to PSD3 Antibody (NBP2-55678).
 

Pathways for PSD3 Antibody (NBP2-55678)

View related products by pathway.

PTMs for PSD3 Antibody (NBP2-55678)

Learn more about PTMs related to PSD3 Antibody (NBP2-55678).

Blogs on PSD3

There are no specific blogs for PSD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSD3