NUDC Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NUDC Antibody [NBP1-89517] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-NUDC antibody NBP1-89517 (A) shows similar protein distribution across tissues to independent antibody NBP1-89510 (B).

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex shows weak to moderate cytoplasmic and nuclear positivity in neurons.

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.

Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.

Western Blot: NUDC Antibody [NBP1-89517] - Analysis using Anti-NUDC antibody NBP1-89517 (A) shows similar pattern to independent antibody NBP1-89510 (B).

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NUDC Protein (NBP1-89517PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NUDC Antibody - BSA Free

• HNUDC
• MNUDC
• NPD011
• nuclear distribution gene C (A.nidulans) homolog
• nuclear distribution gene C homolog (A. nidulans)
• Nuclear distribution protein C homolog
• nuclear migration protein nudC
• NudC

Background

NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUDC Antibody (NBP1-89517)(1)

Publication using NBP1-89517

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: NUDC