NUDC Antibody

Images

 
Independent Antibodies: Western Blot: NUDC Antibody [NBP1-89517] - Analysis using Anti-NUDC antibody NBP1-89517 (A) shows similar pattern to independent antibody NBP1-89510 (B).
Immunocytochemistry/ Immunofluorescence: NUDC Antibody [NBP1-89517] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Western Blot: NUDC Antibody [NBP1-89517] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in seminiferus duct cells.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining in human fallopian tube and pancreas tissues using anti-NUDC antibody. Corresponding NUDC RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex, endometrium, pancreas and testis using Anti-NUDC antibody NBP1-89517 (A) shows similar ...read more
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human endometrium.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human testis.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex shows weak to moderate cytoplasmic and nuclear positivity in neurons.
Independent Antibodies: Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-NUDC antibody NBP1-89517 (A) shows similar ...read more
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUDC Protein (NBP1-89517PEP)
Publications
Read Publication using NBP1-89517.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUDC Antibody

  • HNUDC
  • MNUDC
  • NPD011
  • nuclear distribution gene C (A.nidulans) homolog
  • nuclear distribution gene C homolog (A. nidulans)
  • Nuclear distribution protein C homolog
  • nuclear migration protein nudC
  • NudC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1016
Species: Hu
Applications: Neut, WB
288-TPN/CF
Species: Hu
Applications: BA
DPLG70
Species: Hu
Applications: ELISA
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84581
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-27544
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-85485
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01086
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-82939
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-75686
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67446
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
MAB6640
Species: Hu, Mu, Rt
Applications: WB
7954-GM/CF
Species: Hu
Applications: BA

Publications for NUDC Antibody (NBP1-89517)(1)

Reviews for NUDC Antibody (NBP1-89517) (0)

There are no reviews for NUDC Antibody (NBP1-89517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NUDC Antibody (NBP1-89517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUDC Products

Bioinformatics Tool for NUDC Antibody (NBP1-89517)

Discover related pathways, diseases and genes to NUDC Antibody (NBP1-89517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDC Antibody (NBP1-89517)

Discover more about diseases related to NUDC Antibody (NBP1-89517).
 

Pathways for NUDC Antibody (NBP1-89517)

View related products by pathway.

PTMs for NUDC Antibody (NBP1-89517)

Learn more about PTMs related to NUDC Antibody (NBP1-89517).
 

Research Areas for NUDC Antibody (NBP1-89517)

Find related products by research area.

Blogs on NUDC

There are no specific blogs for NUDC, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDC