NUDC Antibody


Western Blot: NUDC Antibody [NBP1-89517] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: NUDC Antibody [NBP1-89517] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in seminiferus duct cells.
Western Blot: NUDC Antibody [NBP1-89517] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NUDC Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWT
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUDC Protein (NBP1-89517PEP)
Read Publication using NBP1-89517.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NUDC Antibody

  • NPD011
  • nuclear distribution gene C (A.nidulans) homolog
  • nuclear distribution gene C homolog (A. nidulans)
  • Nuclear distribution protein C homolog
  • nuclear migration protein nudC
  • NudC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Neut
Species: Hu
Applications: WB, ICC/IF, IP, PLA
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUDC Antibody (NBP1-89517)(1)

Reviews for NUDC Antibody (NBP1-89517) (0)

There are no reviews for NUDC Antibody (NBP1-89517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NUDC Antibody (NBP1-89517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUDC Products

Bioinformatics Tool for NUDC Antibody (NBP1-89517)

Discover related pathways, diseases and genes to NUDC Antibody (NBP1-89517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDC Antibody (NBP1-89517)

Discover more about diseases related to NUDC Antibody (NBP1-89517).

Pathways for NUDC Antibody (NBP1-89517)

View related products by pathway.

PTMs for NUDC Antibody (NBP1-89517)

Learn more about PTMs related to NUDC Antibody (NBP1-89517).

Research Areas for NUDC Antibody (NBP1-89517)

Find related products by research area.

Blogs on NUDC

There are no specific blogs for NUDC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUDC Antibody and receive a gift card or discount.


Gene Symbol NUDC