CAMKID Antibody

Images

 
Western Blot: CAMKID Antibody [NBP1-85589] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: CAMKID Antibody [NBP1-85589] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear membrane positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAMKID Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAMK1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAMKID Protein (NBP1-85589PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAMKID Antibody

  • calcium/calmodulin-dependent protein kinase ID
  • calcium/calmodulin-dependent protein kinase type 1D
  • CaM kinase I delta
  • CaM kinase ID
  • CaM-K1
  • CaMKI delta
  • CaM-KI delta
  • CaMKID
  • CaMKI-like protein kinase
  • CKLiKEC 2.7.11.17
  • EC 2.7.11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82916
Species: Hu
Applications: IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-82134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7899
Species: Hu
Applications: WB, IHC
NBP1-28904
Species: Hu, Po
Applications: ICC/IF (-), WB, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49620
Species: Hu
Applications: WB, IA, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003087-M02
Species: Hu
Applications: WB, ELISA
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
H00001646-M03
Species: Hu
Applications: WB, ELISA
AF7318
Species: Hu
Applications: IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-85589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CAMKID Antibody (NBP1-85589) (0)

There are no publications for CAMKID Antibody (NBP1-85589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAMKID Antibody (NBP1-85589) (0)

There are no reviews for CAMKID Antibody (NBP1-85589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CAMKID Antibody (NBP1-85589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAMKID Products

Bioinformatics Tool for CAMKID Antibody (NBP1-85589)

Discover related pathways, diseases and genes to CAMKID Antibody (NBP1-85589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAMKID Antibody (NBP1-85589)

Discover more about diseases related to CAMKID Antibody (NBP1-85589).
 

Pathways for CAMKID Antibody (NBP1-85589)

View related products by pathway.

PTMs for CAMKID Antibody (NBP1-85589)

Learn more about PTMs related to CAMKID Antibody (NBP1-85589).
 

Research Areas for CAMKID Antibody (NBP1-85589)

Find related products by research area.

Blogs on CAMKID

There are no specific blogs for CAMKID, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAMKID Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMK1D