NUDCD3 Antibody - BSA Free

Western Blot: NUDCD3 Antibody [NBP1-82939] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: NUDCD3 Antibody [NBP1-82939] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human liver.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human cerebral cortex, liver, lymph node and skin using Anti-NUDCD3 antibody NBP1-82939 (A) shows similar protein distribution across tissues to independent antibody NBP1-82940 (B).

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human skin.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human lymph node.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDCD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDCD3 Antibody - BSA Free (NBP1-82939) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-NUDCD3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGAAE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDCD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IP reported in scientific literature (PMID: 25205765). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NUDCD3 Protein (NBP1-82939PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25205765).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NUDCD3 Antibody - BSA Free

• KIAA1068NudCL
• NudC domain containing 3
• nudC domain-containing protein 3
• NudC-like protein

Background

The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUDCD3 Antibody (NBP1-82939)(1)

Publication using NBP1-82939

• Asante D, Stevenson NL, Stephens DJ. Subunit composition of the human cytoplasmic dynein-2 complex. J Cell Sci 2014-11-01 [PMID: 25205765] (IP, Human)

Bioinformatics

• Gene Symbol: NUDCD3