Western Blot: NUDCD3 Antibody [NBP1-82939] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NUDCD3 Antibody [NBP1-82939] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human liver.
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Independent Antibodies: Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human cerebral cortex, liver, lymph node and skin using Anti-NUDCD3 antibody NBP1-82939 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human skin.
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82939] - Staining of human lymph node.
Novus Biologicals Rabbit NUDCD3 Antibody - BSA Free (NBP1-82939) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-NUDCD3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTELDGHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGAAE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDCD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IP reported in scientific literature (PMID: 25205765). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Human reactivity reported in scientific literature (PMID: 25205765).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for NUDCD3 Antibody - BSA Free
KIAA1068NudCL
NudC domain containing 3
nudC domain-containing protein 3
NudC-like protein
Background
The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NUDCD3 Antibody - BSA Free and receive a gift card or discount.