NUDCD3 Antibody


Western Blot: NUDCD3 Antibody [NBP1-82938] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82938] - Staining in human cerebral cortex and liver tissues using anti-NUDCD3 antibody. Corresponding NUDCD3 RNA-seq data are presented for the same tissues.
Western Blot: NUDCD3 Antibody [NBP1-82938] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-399
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82938] - Staining of human gall bladder shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82938] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82938] - Staining of human liver shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NUDCD3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVVKGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSL
Specificity of human, mouse, rat NUDCD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUDCD3 Protein (NBP1-82938PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NUDCD3 Antibody

  • KIAA1068NudCL
  • NudC domain containing 3
  • nudC domain-containing protein 3
  • NudC-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Mu
Applications: WB, IHC, Neut
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUDCD3 Antibody (NBP1-82938) (0)

There are no publications for NUDCD3 Antibody (NBP1-82938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDCD3 Antibody (NBP1-82938) (0)

There are no reviews for NUDCD3 Antibody (NBP1-82938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDCD3 Antibody (NBP1-82938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUDCD3 Products

Bioinformatics Tool for NUDCD3 Antibody (NBP1-82938)

Discover related pathways, diseases and genes to NUDCD3 Antibody (NBP1-82938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NUDCD3 Antibody (NBP1-82938)

View related products by pathway.

PTMs for NUDCD3 Antibody (NBP1-82938)

Learn more about PTMs related to NUDCD3 Antibody (NBP1-82938).

Blogs on NUDCD3

There are no specific blogs for NUDCD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUDCD3 Antibody and receive a gift card or discount.


Gene Symbol NUDCD3