NUDCD3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82938] - Staining in human cerebral cortex and liver tissues using anti-NUDCD3 antibody. Corresponding NUDCD3 RNA-seq data are presented for the same tissues.

Western Blot: NUDCD3 Antibody [NBP1-82938] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Western Blot: NUDCD3 Antibody [NBP1-82938] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-399

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82938] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: NUDCD3 Antibody [NBP1-82938] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDCD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDCD3 Antibody - BSA Free (NBP1-82938) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVVKGKQVSVALSSSSIRVAMLEENGERVLMEGKLTHKINTESSLWSL
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDCD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NUDCD3 Protein (NBP1-82938PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NUDCD3 Antibody - BSA Free

• KIAA1068NudCL
• NudC domain containing 3
• nudC domain-containing protein 3
• NudC-like protein

Background

The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDCD3