Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-39057] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFE2L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Nuclear Factor Erythroid 2 Related Factor 1 Protein (NBP2-39057PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nuclear Factor Erythroid 2 Related Factor 1 Antibody - BSA Free

• FLJ00380
• HBZ17
• LCR-F1
• Locus control region-factor 1
• NF-E2-related factor 1
• NFE2-related factor 1
• NRF1TCF11
• nuclear factor (erythroid-derived 2)-like 1
• nuclear factor erythroid 2-related factor 1
• Nuclear factor, erythroid derived 2, like 1
• TCF-11
• transcription factor 11 (basic leucine zipper type)
• Transcription factor 11
• Transcription factor HBZ17
• Transcription factor LCR-F1

Background

Nuclear Factor Erythroid 2 Related Factor 1 is a 772 amino acid transcription factor. It interacts with KEAP1 and activates globin gene expression in erythrocytes. It may play a role in hepatits and anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFE2L1
• Uniprot:
  • Q14494(Human)