Nuclear Factor Erythroid 2 Related Factor 1 Antibody

Images

 
Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-39057] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-39057] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nuclear Factor Erythroid 2 Related Factor 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
Specificity
Specificity of human Nuclear Factor Erythroid 2 Related Factor 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFE2L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Nuclear Factor Erythroid 2 Related Factor 1 Lysate (NBP2-65523)
Control Peptide
Nuclear Factor Erythroid 2 Related Factor 1 Protein (NBP2-39057PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nuclear Factor Erythroid 2 Related Factor 1 Antibody

  • FLJ00380
  • HBZ17
  • LCR-F1
  • Locus control region-factor 1
  • NF-E2-related factor 1
  • NFE2-related factor 1
  • NRF1TCF11
  • nuclear factor (erythroid-derived 2)-like 1
  • nuclear factor erythroid 2-related factor 1
  • Nuclear factor, erythroid derived 2, like 1
  • TCF-11
  • transcription factor 11 (basic leucine zipper type)
  • Transcription factor 11
  • Transcription factor HBZ17
  • Transcription factor LCR-F1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46173
Species: Hu
Applications: WB
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP

Publications for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057) (0)

There are no publications for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057) (0)

There are no reviews for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057)

Discover related pathways, diseases and genes to Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057)

Discover more about diseases related to Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057).
 

Pathways for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057)

View related products by pathway.

PTMs for Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057)

Learn more about PTMs related to Nuclear Factor Erythroid 2 Related Factor 1 Antibody (NBP2-39057).

Blogs on Nuclear Factor Erythroid 2 Related Factor 1

There are no specific blogs for Nuclear Factor Erythroid 2 Related Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nuclear Factor Erythroid 2 Related Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2L1
Uniprot