NSUN5 Antibody


Western Blot: NSUN5 Antibody [NBP1-89416] - Analysis in human cell lines Caco-2 and U-251MG using anti-NSUN5 antibody. Corresponding NSUN5 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: NSUN5 Antibody [NBP1-89416] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: NSUN5 Antibody [NBP1-89416] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.
Western Blot: NSUN5 Antibody [NBP1-89416] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NSUN5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL
Specificity of human NSUN5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NSUN5 Protein (NBP1-89416PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NSUN5 Antibody

  • EC 2.1.1.-
  • FLJ10267
  • member 5A
  • MGC986
  • NOL1
  • NOL1/NOP2/Sun domain family member 5
  • NOL1/NOP2/Sun domain family, member 5
  • NOL1R(NOL1)
  • NOL1-related protein
  • NOP2/Sun domain family, member 5
  • NSUN5A
  • p120
  • putative methyltransferase NSUN5
  • WBSCR20
  • WBSCR20A
  • Williams-Beuren syndrome chromosomal region 20A protein
  • Williams-Beuren syndrome critical region protein 20 copy A
  • Ynl022cL


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NSUN5 Antibody (NBP1-89416) (0)

There are no publications for NSUN5 Antibody (NBP1-89416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSUN5 Antibody (NBP1-89416) (0)

There are no reviews for NSUN5 Antibody (NBP1-89416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NSUN5 Antibody (NBP1-89416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NSUN5 Products

Bioinformatics Tool for NSUN5 Antibody (NBP1-89416)

Discover related pathways, diseases and genes to NSUN5 Antibody (NBP1-89416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSUN5 Antibody (NBP1-89416)

Discover more about diseases related to NSUN5 Antibody (NBP1-89416).

Pathways for NSUN5 Antibody (NBP1-89416)

View related products by pathway.

Blogs on NSUN5

There are no specific blogs for NSUN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NSUN5 Antibody and receive a gift card or discount.


Gene Symbol NSUN5