NRAP Antibody

Images

 
Immunohistochemistry: NRAP Antibody [NBP2-32650] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQCKSVFHWDMKSKDKEGAPNRQPLANERAYWTGYGEGNAWCPGALPDPEIVRMVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NRAP Protein (NBP2-32650PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRAP Antibody

  • nebulin-related anchoring protein
  • nebulin-related-anchoring protein
  • N-RAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-45223
Species: Hu, Mu, Ca
Applications: IHC-P, PEP-ELISA
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP2-19562
Species: Hu, Mu
Applications: WB, ICC/IF
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89300
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32650
Species: Hu
Applications: IHC, IHC-P

Publications for NRAP Antibody (NBP2-32650) (0)

There are no publications for NRAP Antibody (NBP2-32650).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRAP Antibody (NBP2-32650) (0)

There are no reviews for NRAP Antibody (NBP2-32650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NRAP Antibody (NBP2-32650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRAP Products

Bioinformatics Tool for NRAP Antibody (NBP2-32650)

Discover related pathways, diseases and genes to NRAP Antibody (NBP2-32650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRAP Antibody (NBP2-32650)

Discover more about diseases related to NRAP Antibody (NBP2-32650).
 

Pathways for NRAP Antibody (NBP2-32650)

View related products by pathway.

PTMs for NRAP Antibody (NBP2-32650)

Learn more about PTMs related to NRAP Antibody (NBP2-32650).

Blogs on NRAP

There are no specific blogs for NRAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRAP