NRAP Antibody - BSA Free

Immunohistochemistry-Paraffin: NRAP Antibody [NBP2-32650] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry: NRAP Antibody [NBP2-32650] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: NRAP Antibody [NBP2-32650] - Staining of human heart muscle, lymphoid tissues, placenta and skeletal muscle using Anti-NRAP antibody NBP2-32650 (A) shows similar protein distribution across tissues to independent antibody NBP1-86267 (B).

Immunohistochemistry-Paraffin: NRAP Antibody [NBP2-32650] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: NRAP Antibody [NBP2-32650] - Staining of human heart muscle shows strong positivity in intercalated discs in myocytes.

Immunohistochemistry-Paraffin: NRAP Antibody [NBP2-32650] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NRAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NRAP Antibody - BSA Free (NBP2-32650) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQCKSVFHWDMKSKDKEGAPNRQPLANERAYWTGYGEGNAWCPGALPDPEIVRMVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NRAP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NRAP Protein (NBP2-32650PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NRAP Antibody - BSA Free

• nebulin-related anchoring protein
• nebulin-related-anchoring protein
• N-RAP

Background

NRAP may be involved in anchoring the terminal actin filaments in the myofibril to the membrane and in transmitting tension from the myofibrils to the extracellular matrix

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NRAP