FLNC Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FLNC Antibody [NBP1-89300] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLNC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLNC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLNC Protein (NBP1-89300PEP)
Publications
Read Publications using
NBP1-89300 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLNC Antibody

  • ABP-280
  • ABP280A
  • ABP-280-like protein
  • ABPA
  • ABP-L
  • ABPLABP-L, gamma filamin
  • Actin-binding-like protein
  • filamin 2
  • filamin C, gamma (actin binding protein 280)
  • filamin C, gamma
  • filamin-2
  • filamin-C
  • FLJ10186
  • FLN2actin binding protein 280
  • FLNc
  • FLN-C
  • Gamma-filamin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
NB500-470
Species: Hu
Applications: ELISA, Flow
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for FLNC Antibody (NBP1-89300)(3)

Reviews for FLNC Antibody (NBP1-89300) (0)

There are no reviews for FLNC Antibody (NBP1-89300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FLNC Antibody (NBP1-89300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLNC Products

Bioinformatics Tool for FLNC Antibody (NBP1-89300)

Discover related pathways, diseases and genes to FLNC Antibody (NBP1-89300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLNC Antibody (NBP1-89300)

Discover more about diseases related to FLNC Antibody (NBP1-89300).
 

Pathways for FLNC Antibody (NBP1-89300)

View related products by pathway.

PTMs for FLNC Antibody (NBP1-89300)

Learn more about PTMs related to FLNC Antibody (NBP1-89300).

Blogs on FLNC

There are no specific blogs for FLNC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLNC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLNC