FLNC Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FLNC Antibody [NBP1-89300] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining shown in green.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining of human skin shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Staining in human skeletal muscle and skin tissues using anti-FLNC antibody. Corresponding FLNC RNA-seq data are presented for ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: FLNC Antibody [NBP1-89300] - Analysis in human skeletal muscle and liver tissues. Corresponding FLNC RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FLNC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
Specificity
Specificity of human FLNC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLNC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLNC Recombinant Protein Antigen (NBP1-89300PEP)
Publications
Read Publications using
NBP1-89300 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29078393).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLNC Antibody

  • ABP-280
  • ABP280A
  • ABP-280-like protein
  • ABPA
  • ABP-L
  • ABPLABP-L, gamma filamin
  • Actin-binding-like protein
  • filamin 2
  • filamin C, gamma (actin binding protein 280)
  • filamin C, gamma
  • filamin-2
  • filamin-C
  • FLJ10186
  • FLN2actin binding protein 280
  • FLNc
  • FLN-C
  • Gamma-filamin

Background

FLNC, Filamin-c, Filamin-2 (FLN2), Actin binding-like protein (APBL) (290.8 kDa) is an isoform of the Filamin proteins family. Filamins are broadly expressed and function as actin-binding and actin-crosslinking proteins. Structurally, Filamins consist of three main domains; N-terminal actin-binding domain, multiple central immunoglobulin (Ig) domains, and a C-terminal domain which supports homodimerization (1, 2). Functionally, Filamins play a role in cytoskeleton structure through interactions with actin, but they are implicated in a wide range of processes through their interactions with diverse molecular partners such as signaling molecules (MKK4, JNK1), ion channels (Kv4.2, Kir2.1), receptors (Insulin, Calcitonin), and transcription factors (Smad1-6, Foxc1) (3).

Three isoforms of Filamin are expressed in mammals, identified as FLNA, FLNB and FLNC. FLNC is considered a muscle specific Filamin isoform for its high expression in cardiac and skeletal muscles. In muscle tissue, FLNC localizes to the Z-line, sarcolemma, myotendinous and intercalated disks (2). FLNC interacts with various muscle proteins via a non-conserved sequence within its Ig domain 20. Some muscle binding partners for FLNC include gamma and delta-sarcoglycans in the sarcolemma, and FATZ, myozenins, myotilin and myopodin in the Z-discs (2, 4). FLNC variants are associated with various inherited pathological conditions including myofibrillar myopathy 5, distal myopathy 4, dilated cardiomyopathy, hypertrophic cardiomyopathy, and restrictive cardiomyopathy (2, 5).

References

1. Chiang, W., Greaser, M. L., & Lyons, G. E. (2000). Filamin isogene expression during mouse myogenesis. Developmental Dynamics. https://doi.org/10.1002/(sici)1097-0177(200001)217:1<99::aid-dvdy9>3.3.co;2-x

2. Leber, Y., Ruparelia, A. A., Kirfel, G., van der Ven, P. F. M., Hoffmann, B., Merkel, R.,... Furst, D. O. (2016). Filamin C is a highly dynamic protein associated with fast repair of myofibrillar microdamage. Human Molecular Genetics. https://doi.org/10.1093/hmg/ddw135

3. Nakamura, F., Stossel, T. P., & Hartwig, J. H. (2011). The filamins: Organizers of cell structure and function. Cell Adhesion and Migration. https://doi.org/10.4161/cam.5.2.14401

4. Thompson, T. G., Chan, Y. M., Hack, A. A., Brosius, M., Rajala, M., Lidov, H. G. W.,... Kunkel, L. M. (2000). Filamin 2 (FLN2): A muscle-specific sarcoglycan interacting protein. Journal of Cell Biology. https://doi.org/10.1083/jcb.148.1.115

5. Brodehl, A., Ferrier, R. A., Hamilton, S. J., Greenway, S. C., Brundler, M. A., Yu, W.,... Scherer, S. (2016). Mutations in FLNC are Associated with Familial Restrictive Cardiomyopathy. Human Mutation. https://doi.org/10.1002/humu.22942

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
AF2656
Species: Hu
Applications: WB, IHC
H00002316-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NBP2-38361
Species: Hu
Applications: IHC, IHC-P
NB7343
Species: Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00011155-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, RNAi, S-ELISA
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80306
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-55967
Species: Hu
Applications: ICC/IF
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89300
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FLNC Antibody (NBP1-89300)(5)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(2)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species

Reviews for FLNC Antibody (NBP1-89300) (0)

There are no reviews for FLNC Antibody (NBP1-89300). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FLNC Antibody (NBP1-89300) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FLNC Products

Array NBP1-89300

Bioinformatics Tool for FLNC Antibody (NBP1-89300)

Discover related pathways, diseases and genes to FLNC Antibody (NBP1-89300). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLNC Antibody (NBP1-89300)

Discover more about diseases related to FLNC Antibody (NBP1-89300).
 

Pathways for FLNC Antibody (NBP1-89300)

View related products by pathway.

PTMs for FLNC Antibody (NBP1-89300)

Learn more about PTMs related to FLNC Antibody (NBP1-89300).

Blogs on FLNC

There are no specific blogs for FLNC, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLNC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLNC