Nebulin Antibody

Images

 
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Analysis in human skeletal muscle and cerebral cortex tissues using NBP1-87752 antibody. Corresponding NEB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nebulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DTPDMLRAKNATQILNEKEYKRDLELEVKGRGLNAMANETPDFMRARNATDIASQIKYKQSAEMEKANFTSVVDTPEIIHAQQVKNLSSQKKYKEDAEKSMSYYETVLDTPEIQRVRENQKNFSLLQYQCDL
Specificity
Specificity of human Nebulin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nebulin Protein (NBP1-87752PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nebulin Antibody

  • DKFZp686C1456
  • FLJ11505
  • FLJ36536
  • FLJ39568
  • FLJ39584
  • NEB177D
  • nebulin
  • NEM2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP1-45223
Species: Hu, Mu, Ca
Applications: IHC, IHC-P, PEP-ELISA
H00007170-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-95197
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007138-B01P
Species: Hu, In
Applications: WB
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, Single-Cell Western
NBP1-86267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB4218
Species: Hu
Applications: WB, IHC

Publications for Nebulin Antibody (NBP1-87752) (0)

There are no publications for Nebulin Antibody (NBP1-87752).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nebulin Antibody (NBP1-87752) (0)

There are no reviews for Nebulin Antibody (NBP1-87752). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nebulin Antibody (NBP1-87752) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nebulin Products

Bioinformatics Tool for Nebulin Antibody (NBP1-87752)

Discover related pathways, diseases and genes to Nebulin Antibody (NBP1-87752). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nebulin Antibody (NBP1-87752)

Discover more about diseases related to Nebulin Antibody (NBP1-87752).
 

Pathways for Nebulin Antibody (NBP1-87752)

View related products by pathway.

PTMs for Nebulin Antibody (NBP1-87752)

Learn more about PTMs related to Nebulin Antibody (NBP1-87752).
 

Research Areas for Nebulin Antibody (NBP1-87752)

Find related products by research area.

Blogs on Nebulin

There are no specific blogs for Nebulin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nebulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEB