NPAT Antibody


Immunocytochemistry/ Immunofluorescence: NPAT Antibody [NBP2-58659] - Staining of human cell line RH-30 shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

NPAT Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNQAVSPNFSQGSAIIIASPVQPVLQGMVGMIPVSVVGQNGNNFSTPPRQVLHMPLTAPVCNRSIPQFPVPPKSQKAQGLRNKPCIGKQVNNLVDSSGHSV
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPAT Recombinant Protein Antigen (NBP2-58659PEP)

Reactivity Notes

Mouse 83%, Rat 85%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NPAT Antibody

  • CAND3
  • E14
  • E14/NPAT
  • Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus
  • Nuclear Protein Of The ATM Locus
  • Nuclear Protein, Ataxia-Telangiectasia Locus
  • Nuclear Protein, Coactivator Of Histone Transcription
  • Nuclear Protein, Co-Activator Of Histone Transcription
  • p220
  • Protein NPAT


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Ca(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IF, MI
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF

Publications for NPAT Antibody (NBP2-58659) (0)

There are no publications for NPAT Antibody (NBP2-58659).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAT Antibody (NBP2-58659) (0)

There are no reviews for NPAT Antibody (NBP2-58659). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NPAT Antibody (NBP2-58659) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NPAT Products

Array NBP2-58659

Bioinformatics Tool for NPAT Antibody (NBP2-58659)

Discover related pathways, diseases and genes to NPAT Antibody (NBP2-58659). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPAT Antibody (NBP2-58659)

Discover more about diseases related to NPAT Antibody (NBP2-58659).

Pathways for NPAT Antibody (NBP2-58659)

View related products by pathway.

PTMs for NPAT Antibody (NBP2-58659)

Learn more about PTMs related to NPAT Antibody (NBP2-58659).

Blogs on NPAT

There are no specific blogs for NPAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NPAT Antibody and receive a gift card or discount.


Gene Symbol NPAT