Notch-1 Recombinant Protein Antigen

Images

 
There are currently no images for Notch-1 Recombinant Protein Antigen (NBP2-57913PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Notch-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Notch-1.

Source: E. coli

Amino Acid Sequence: GGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NOTCH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57913.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Notch-1 Recombinant Protein Antigen

  • EC 2.1.2.11
  • EC 3.4.21.68
  • hN1
  • Notch (Drosophila) homolog 1 (translocation-associated)
  • notch 1Notch homolog 1, translocation-associated (Drosophila)
  • Notch homolog 1, translocation-associated
  • Notch1
  • Notch-1
  • TAN1
  • TAN1neurogenic locus notch homolog protein 1
  • Translocation-associated notch protein TAN-1

Background

Notch is synthesized in the endoplasmic reticulum as an inactive form which is proteolytically cleaved by a furin-like convertase (S1 cleavage) in the trans-golgi network before it reaches the plasma membrane to yield an active, ligand-accessible form. Cleavage results in a C-terminal fragment N(TM) and a N-terminal fragment N(EC). Following ligand binding, it is cleaved (S2 cleavage) by TNF-alpha converting enzyme (TACE) to yield a membrane-associated intermediate fragment called Notch extracellular truncation (NEXT). This fragment is then cleaved by presenilin-dependent gamma-secretase (S3 cleavage) to release the intracellular domain (NICD) from the membrane which then translocates to the nucleus to activate transcription of downstream genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
AF3847
Species: Hu
Applications: ICC, WB
AF3735
Species: Hu
Applications: IHC, WB
AF4079
Species: Hu
Applications: ICC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF1308
Species: Mu
Applications: Block, CyTOF-ready, Flow, IF, IHC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00055294-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
AF1389
Species: Mu
Applications: ICC, IHC, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
1726-JG
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
NBP2-27174
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
1277-JG
Species: Hu
Applications: BA

Publications for Notch-1 Recombinant Protein Antigen (NBP2-57913PEP) (0)

There are no publications for Notch-1 Recombinant Protein Antigen (NBP2-57913PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Notch-1 Recombinant Protein Antigen (NBP2-57913PEP) (0)

There are no reviews for Notch-1 Recombinant Protein Antigen (NBP2-57913PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Notch-1 Recombinant Protein Antigen (NBP2-57913PEP). (Showing 1 - of FAQ).

    Additional Notch-1 Products

    Research Areas for Notch-1 Recombinant Protein Antigen (NBP2-57913PEP)

    Find related products by research area.

    Blogs on Notch-1.

    Notch1 - A multifunctional transmembrane receptor
    Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process...  Read full blog post.

    Customers Who Bought This Also Bought

    Contact Information

    Product PDFs

    Calculators

    Concentration Calculator

    The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

    =
    ÷

    Molarity Calculator

    Calculate the mass, volume, or concentration required for a solution.

    The molarity calculator is based on the following equation:

    Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

    As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

    =
    x
    x
    g/mol

    Review this Product

    Be the first to review our Notch-1 Recombinant Protein Antigen and receive a gift card or discount.

    Bioinformatics

    Gene Symbol NOTCH1