Nodal Antibody


Immunocytochemistry/ Immunofluorescence: Nodal Antibody [NBP2-13664] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Nodal Antibody [NBP2-13664] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Nodal Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVL EVTRPLSKWLKHPGALEKQMSRV
Specificity of human Nodal antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nodal Protein (NBP2-13664PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Nodal Antibody

  • BMP-16
  • MGC138230
  • nodal homolog (mouse)
  • nodal homolog
  • Nodal
  • nodal, mouse, homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
Species: Hu
Applications: WB, Block
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Rt
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for Nodal Antibody (NBP2-13664) (0)

There are no publications for Nodal Antibody (NBP2-13664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nodal Antibody (NBP2-13664) (0)

There are no reviews for Nodal Antibody (NBP2-13664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nodal Antibody (NBP2-13664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Nodal Products

Bioinformatics Tool for Nodal Antibody (NBP2-13664)

Discover related pathways, diseases and genes to Nodal Antibody (NBP2-13664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nodal Antibody (NBP2-13664)

Discover more about diseases related to Nodal Antibody (NBP2-13664).

Pathways for Nodal Antibody (NBP2-13664)

View related products by pathway.

PTMs for Nodal Antibody (NBP2-13664)

Learn more about PTMs related to Nodal Antibody (NBP2-13664).

Research Areas for Nodal Antibody (NBP2-13664)

Find related products by research area.

Blogs on Nodal

There are no specific blogs for Nodal, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Nodal Antibody and receive a gift card or discount.


Gene Symbol NODAL