NME4 Antibody

Images

 
Western Blot: NME4 Antibody [H00004833-B01P] - Analysis of NME4 expression in transfected 293T cell line by NME4 polyclonal antibody. Lane 1: NME4 transfected lysate(20.57 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NME4 Antibody Summary

Immunogen
NME4 (NP_005000.1, 1 a.a. - 187 a.a.) full-length human protein. MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NME4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NME4 Antibody

  • EC 2.7.4.6
  • NDP kinase, mitochondrial
  • NDPK-D
  • NM23D
  • nm23-H4mitochondrial
  • non-metastatic cells 4, protein expressed in

Background

The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF3014
Species: Hu
Applications: WB, IHC, Block
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-56908
Species: Hu
Applications: ICC/IF
H00009735-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004833-B01P
Species: Hu
Applications: WB

Publications for NME4 Antibody (H00004833-B01P) (0)

There are no publications for NME4 Antibody (H00004833-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NME4 Antibody (H00004833-B01P) (0)

There are no reviews for NME4 Antibody (H00004833-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NME4 Antibody (H00004833-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NME4 Products

Bioinformatics Tool for NME4 Antibody (H00004833-B01P)

Discover related pathways, diseases and genes to NME4 Antibody (H00004833-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NME4 Antibody (H00004833-B01P)

Discover more about diseases related to NME4 Antibody (H00004833-B01P).
 

Pathways for NME4 Antibody (H00004833-B01P)

View related products by pathway.

PTMs for NME4 Antibody (H00004833-B01P)

Learn more about PTMs related to NME4 Antibody (H00004833-B01P).
 

Research Areas for NME4 Antibody (H00004833-B01P)

Find related products by research area.

Blogs on NME4

There are no specific blogs for NME4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NME4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NME4
Uniprot