Novus Biologicals products are now on bio-techne.com

KNTC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KNTC1 Antibody [NBP1-83032] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown ...read more
Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human tonsil shows weak cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.
Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: KNTC1 Antibody [NBP1-83032] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KNTC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKMLESLLNSMSASVSLQKLCPWFKNDVIPFVRRTVPEGQIILAKWLEQAARNLELTDKANWPENGLQLAEIFFTAEKTDELGLASSWHWISLKDYQNTEEVCQLRTLVNNLR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KNTC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KNTC1 Protein (NBP1-83032PEP)
Publications
Read Publication using
NBP1-83032 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KNTC1 Antibody

  • FLJ36151
  • hRod
  • hsROD
  • KIAA0166Rough Deal homolog, centromere/kinetochore protein
  • kinetochore associated 1
  • kinetochore-associated protein 1
  • Rod
  • RODHsROD
  • Rough deal homolog

Background

KNTC1 encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
H00138428-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-38751
Species: Hu
Applications: IHC, IHC-P, WB
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
DY805
Species: Hu
Applications: ELISA
NBP2-21057
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-02487
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
H00006241-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KNTC1 Antibody (NBP1-83032)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for KNTC1 Antibody (NBP1-83032) (0)

There are no reviews for KNTC1 Antibody (NBP1-83032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KNTC1 Antibody (NBP1-83032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KNTC1 Products

Array NBP1-83032

Research Areas for KNTC1 Antibody (NBP1-83032)

Find related products by research area.

Blogs on KNTC1

There are no specific blogs for KNTC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KNTC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KNTC1