NLRP7 Antibody

Images

 
Immunohistochemistry-Paraffin: NLRP7 Antibody [NBP2-13661] Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLRP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENW IRNATVNILEEMNLTELCKMAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NLRP7 Protein (NBP2-13661PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NLRP7 Antibody

  • CLR19.4
  • MGC126471
  • NACHT, leucine rich repeat and PYD containing 7
  • NACHT, LRR and PYD containing protein 7
  • NACHT, LRR and PYD domains-containing protein 7
  • NALP7MGC126470
  • NLR family, pyrin domain containing 7
  • NOD12HYDM
  • Nucleotide-binding oligomerization domain protein 12
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 7
  • PAN7
  • PYPAF3FLJ94610
  • PYRIN-containing APAF1-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76293
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24606
Species: Hu, Mu
Applications: WB
NBP1-92186
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89106
Species: Hu
Applications: IHC, IHC-P
NBP1-69104
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-92324
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44064
Species: Hu
Applications: WB, PEP-ELISA
NBP2-13661
Species: Hu
Applications: IHC, IHC-P

Publications for NLRP7 Antibody (NBP2-13661) (0)

There are no publications for NLRP7 Antibody (NBP2-13661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP7 Antibody (NBP2-13661) (0)

There are no reviews for NLRP7 Antibody (NBP2-13661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NLRP7 Antibody (NBP2-13661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NLRP7 Products

NLRP7 NBP2-13661

Bioinformatics Tool for NLRP7 Antibody (NBP2-13661)

Discover related pathways, diseases and genes to NLRP7 Antibody (NBP2-13661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP7 Antibody (NBP2-13661)

Discover more about diseases related to NLRP7 Antibody (NBP2-13661).
 

Pathways for NLRP7 Antibody (NBP2-13661)

View related products by pathway.

PTMs for NLRP7 Antibody (NBP2-13661)

Learn more about PTMs related to NLRP7 Antibody (NBP2-13661).

Blogs on NLRP7

There are no specific blogs for NLRP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP7