Synaptotagmin 5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725] - Analysis in human cerebral cortex and skeletal muscle tissues using Anti-SYT5 antibody. Corresponding SYT5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Synaptotagmin 5 Antibody [NBP2-62725] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Synaptotagmin 5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYT5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Synaptotagmin 5 Recombinant Protein Antigen (NBP2-62725PEP)

Reactivity Notes

Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Synaptotagmin 5 Antibody - BSA Free

• synaptotagmin Vsynaptotagmin 5
• synaptotagmin-5
• sytV

Background

May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)-dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYT5