Synaptotagmin 5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SYT5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Synaptotagmin 5 Antibody - BSA Free
Background
May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)-dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Fi, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, In
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Bv, Ch, Eq, Ha, Hu, Pm, Rt
Applications: ICC/IF, WB
Publications for Synaptotagmin 5 Antibody (NBP2-62725) (0)
There are no publications for Synaptotagmin 5 Antibody (NBP2-62725).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Synaptotagmin 5 Antibody (NBP2-62725) (0)
There are no reviews for Synaptotagmin 5 Antibody (NBP2-62725).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Synaptotagmin 5 Antibody (NBP2-62725) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Synaptotagmin 5 Products
Research Areas for Synaptotagmin 5 Antibody (NBP2-62725)
Find related products by research area.
|
Blogs on Synaptotagmin 5