NLRP11 Antibody

Images

 
Western Blot: NLRP11 Antibody [NBP1-92186] - Analysis in control (vector only transfected HEK293T lysate) and NLRP11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: NLRP11 Antibody [NBP1-92186] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLRP11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASR
Specificity
Specificity of human NLRP11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NLRP11 Antibody

  • CLR19.6
  • NACHT, leucine rich repeat and PYD containing 11
  • NALP11NACHT, LRR and PYD domains-containing protein 11
  • NLR family, pyrin domain containing 11
  • NOD17PYPAF7
  • Nucleotide-binding oligomerization domain protein 17
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 11
  • PAAD- and NACHT-containing protein 10
  • PAAD- and NACHT-containing protein 10B
  • PAAD-and NACHT domain-containing protein 10
  • PAN10FLJ26273
  • PYPAF6NACHT, LRR and PYD containing protein 11
  • PYRIN-containing APAF1-like protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM, KD
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IM
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-76293
Species: Hu, Mu, Rt, V
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6606
Species: Hu, Mu, Rt
Applications: WB
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56156
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-54899
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00008837-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92186
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NLRP11 Antibody (NBP1-92186) (0)

There are no publications for NLRP11 Antibody (NBP1-92186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP11 Antibody (NBP1-92186) (0)

There are no reviews for NLRP11 Antibody (NBP1-92186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NLRP11 Antibody (NBP1-92186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NLRP11 Products

Bioinformatics Tool for NLRP11 Antibody (NBP1-92186)

Discover related pathways, diseases and genes to NLRP11 Antibody (NBP1-92186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP11 Antibody (NBP1-92186)

Discover more about diseases related to NLRP11 Antibody (NBP1-92186).
 

Pathways for NLRP11 Antibody (NBP1-92186)

View related products by pathway.

Blogs on NLRP11

There are no specific blogs for NLRP11, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP11
Novus 100% Guarantee