NLRP1/NALP1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NLRP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NLRP1/NALP1 Antibody - BSA Free
Background
NALP1 (also known as NAC/CARD7) is a member of the CATERPILLER (CLR) diverse multigene superfamily of immune regulatory proteins (Ting and Davis, 2005). CLR proteins have a variable N-terminal domain, followed by a nucleotide-binding domain (NBD) and leucine-rich repeats (LRR). The N-terminal domain consists of transactivation, CARD, Pyrin or BIR domains, or in some cases is undefined. The CLR family, also known as the NOD family, has its ancient roots in the plant kingdom and is related to the disease resistance (R) gene family that mediates plant immune responses. CLR proteins participate in both innate and adaptive immunity in mammals, some act as sensors that detect pathogen products, and several CLR genes have been linked to susceptibility to immunological diseases. It is thought that the CLR family may have a fundamental importance for the function of the mammalian innate/ancient immune system on par with the Toll-like receptor (TLR) family. NALP1, a member of NALP CLR subfamily, has an N-terminal pyrin domain (PYD), followed by an NBD, LRR, and a C-terminal CARD domain (reviewed in Tschopp. NALP1 is a component of both the inflammasome and apoptosome, suggesting that NALP1 it has important roles in both inflammation and apoptosis. This antibody recognizes NALP1; human NALP1 is a 1473 amino acid protein and migrates at approx. 166 kDa on SDS-PAGE. However, multiple splice variants encoding distinct NALP1 isoforms with varying amino acid lengths have been described and thus the molecular weight detected may vary depending on the isoform(s) expressed.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF
Publications for NLRP1/NALP1 Antibody (NBP2-57196) (0)
There are no publications for NLRP1/NALP1 Antibody (NBP2-57196).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NLRP1/NALP1 Antibody (NBP2-57196) (0)
There are no reviews for NLRP1/NALP1 Antibody (NBP2-57196).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NLRP1/NALP1 Antibody (NBP2-57196) (0)