NKX3.1 Recombinant Protein Antigen

Images

 
There are currently no images for NKX3.1 Recombinant Protein Antigen (NBP2-62726PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NKX3.1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKX3-1.

Source: E. coli

Amino Acid Sequence: MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NKX3-1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62726.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NKX3.1 Recombinant Protein Antigen

  • BAPX2
  • BAPX2homeobox protein Nkx-3.1
  • Homeobox protein NK-3 homolog A
  • NK homeobox (Drosophila), family 3, A
  • NK3 homeobox 1
  • NK3 transcription factor homolog A
  • NK3 transcription factor related, locus 1 (Drosophila)
  • NK3 transcription factor related, locus 1
  • NKX3.1
  • NKX3.1NKX3
  • NKX3-1
  • NKX3A
  • NKX3ANK homeobox, family 3, A

Background

Nkx3.1 is a transcription factor that may play an important role in regulating proliferation of glandular epithelium and in the formation of ducts in the prostate. It has been thought to be one of the target genes of the 8p21 loss of heterozygosity, common in prostate cancer. But neither disruption of the coding region of the gene, nor mutations have been found in prostate cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
262-AR
Species: Hu
Applications: BA
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF3994
Species: Hu
Applications: WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-26876
Species: Hu
Applications: IHC,  IHC-P
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for NKX3.1 Recombinant Protein Antigen (NBP2-62726PEP) (0)

There are no publications for NKX3.1 Recombinant Protein Antigen (NBP2-62726PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX3.1 Recombinant Protein Antigen (NBP2-62726PEP) (0)

There are no reviews for NKX3.1 Recombinant Protein Antigen (NBP2-62726PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NKX3.1 Recombinant Protein Antigen (NBP2-62726PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKX3.1 Products

Research Areas for NKX3.1 Recombinant Protein Antigen (NBP2-62726PEP)

Find related products by research area.

Blogs on NKX3.1

There are no specific blogs for NKX3.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NKX3.1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX3-1