NKX3-2 Antibody - BSA Free

Western Blot: NKX3-2 Antibody [NBP2-87924] - Host: Rabbit. Target Name: NKX3-2. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

Western Blot: NKX3-2 Antibody [NBP2-87924] - WB Suggested Anti-NKX3-2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:2500. Positive Control: Jurkat cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NKX3-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NKX3-2 Antibody - BSA Free (NBP2-87924) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKX3-2. Peptide sequence: AVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCC The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKX3-2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NKX3-2 Antibody - BSA Free

• Bagpipe homeobox protein homolog 1
• BAPX1bagpipe homeobox homolog 1 (Drosophila)
• Homeobox protein NK-3 homolog B
• homeobox protein Nkx-3.2
• MGC138171
• NK3 homeobox 2
• NKX3.2
• NKX3BSMMD

Background

BAPX1 - bagpipe homeobox homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKX3-2