NKp80/KLRF1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KLRF1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NKp80/KLRF1 Antibody - BSA Free
Background
KLRF1 is a gene that codes for a protein that is helps to facilitate the natural killer-mefiated cytolysis of PHA-induced lymphoblasts and is strongly expressed in the peripheral blood leukocytes and the spleen, with a weaker expression in the lymph nodes and the adult liver. There are four isoforms of KLRF1, with lengths of 232, 182, 64, and 78 amino acids and weights of approximately 27, 21, 7, and 9 kDa respectively. There have been studies conducted on diseases and disorders relating to this gene, including hepatitis b and hepatitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Mu
Applications: AgAct, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: Bind
Species: Hu
Applications: Bind
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: ICC/IF
Publications for NKp80/KLRF1 Antibody (NBP3-17283) (0)
There are no publications for NKp80/KLRF1 Antibody (NBP3-17283).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKp80/KLRF1 Antibody (NBP3-17283) (0)
There are no reviews for NKp80/KLRF1 Antibody (NBP3-17283).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NKp80/KLRF1 Antibody (NBP3-17283) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NKp80/KLRF1 Products
Research Areas for NKp80/KLRF1 Antibody (NBP3-17283)
Find related products by research area.
|
Blogs on NKp80/KLRF1