NKp80/KLRF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NKp80/KLRF1 Antibody [NBP3-17283] - Staining of human cell line HAP1 shows localization to plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NKp80/KLRF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NKp80/KLRF1 Antibody - BSA Free (NBP3-17283) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLRF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NKp80/KLRF1 Antibody - BSA Free

• Activating coreceptor NKp80
• CLEC5C
• CLEC5CMGC119908
• C-type lectin domain family 5 member C
• killer cell lectin-like receptor F1
• killer cell lectin-like receptor subfamily F member 1
• killer cell lectin-like receptor subfamily F, member 1
• KLRF1
• Lectin-like receptor F1
• MGC119907
• MGC119909
• ML
• NKp80

Background

KLRF1 is a gene that codes for a protein that is helps to facilitate the natural killer-mefiated cytolysis of PHA-induced lymphoblasts and is strongly expressed in the peripheral blood leukocytes and the spleen, with a weaker expression in the lymph nodes and the adult liver. There are four isoforms of KLRF1, with lengths of 232, 182, 64, and 78 amino acids and weights of approximately 27, 21, 7, and 9 kDa respectively. There have been studies conducted on diseases and disorders relating to this gene, including hepatitis b and hepatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLRF1