NKp80/KLRF1 Antibody - BSA Free

Western Blot: KLRF1 Antibody [NBP1-59036] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NKp80/KLRF1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to KLRF1(killer cell lectin-like receptor subfamily F, member 1) The peptide sequence was selected from the middle region of KLRF1. Peptide sequence QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLRF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NKp80/KLRF1 Antibody - BSA Free

• Activating coreceptor NKp80
• CLEC5C
• CLEC5CMGC119908
• C-type lectin domain family 5 member C
• killer cell lectin-like receptor F1
• killer cell lectin-like receptor subfamily F member 1
• killer cell lectin-like receptor subfamily F, member 1
• KLRF1
• Lectin-like receptor F1
• MGC119907
• MGC119909
• ML
• NKp80

Background

KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release (Kuttruff et al., 2009 [PubMed 18922855]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLRF1
• Uniprot:
  • Q9NZS2(Human)