NKG2A/CD159a/KLRC1 Antibody

Images

 
Western Blot: NKG2A/CD159a/KLRC1 Antibody [NBP1-74093] - Lane: MCF7 cell Lysate, Antibody Titration :1 ug/ml, and Gel concentration :12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKG2A/CD159a/KLRC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of KLRC1. Immunizing peptide sequence SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KLRC1 and was validated on Western blot.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NKG2A/CD159a/KLRC1 Antibody

  • CD159 antigen-like family member A
  • CD159a antigen
  • CD159a
  • C-lectin type II protein
  • killer cell lectin-like receptor subfamily C, member 1
  • Klrc1
  • MGC13374
  • natural killer cell lectin
  • natural killer group protein 2
  • NK cell receptor A
  • NKG2
  • NKG2-1/B activating NK receptor
  • NKG2A
  • NKG2-A
  • NKG2-A/B type II integral membrane protein
  • NKG2-A/B-activating NK receptor
  • NKG2-A/NKG2-B type II integral membrane protein
  • NKG2AMGC59791
  • NKG2-B

Background

NK group 2 member A (NKG2A), also known as killer lectin like receptor c1 (KLRC1) and CD159a, is a ~38 kDa type II transmembrane protein belonging to the C-type lectin superfamily and plays a role in suppression of cytotoxic CD8+ T cell activity and functions as an immune checkpoint (1,2). NKG2A belongs to a group of natural killer (NK) cell inhibitor receptors (IRs) which includes killer immunoglobulin receptors (KIRs), lymphocyte activation gene-3 (LAG-3), T cell immunoreceptor with Ig and ITIM domains (TIGIT), programmed death ligand-1 (PD-1), and T cell immunoglobulin mucin-3 (TIM-3) (1,3). NKG2A is synthesized as a protein of 233 amino acids (aa) with a theoretical molecular weight of 26.3 kDa and is expressed on CD56hi NK cells, NKT cells, and some CD8+ alphabeta T cells (2,4). Together with CD94, NKG2A forms a heterodimer and acts as a receptor for the MHC Class I molecular human leukocyte antigen (HLA)-E (1-3). The NKG2A/CD94 receptor interaction with the HLA-E ligand results in phosphorylation of NKG2A's immunoreceptor tyrosine-based inhibition motifs (ITIMs), causing suppression of activating signals from immunoreceptor tyrosine-based activation motif (ITAM)- containing T cell receptors (TCR) or other activating receptors like NKG2D, via the intracellular phosphatase SHP1 (2,3,5). Overall, cancer cells utilize the NKG2A-HLA-E interaction and signaling to evade immune surveillance by NK cells and T cells (1-3,5-6).

Similar to cytotoxic T lymphocyte associated protein 4 (CTLA-4) and PD-1, NKG2A has become a prominent target for immune checkpoint blockade and cancer immunotherapy (1-3,5-6). Monalizumab is a novel IgG4 monoclonal antibody developed for blocking NKG2A's interaction with HLA-E and has shown promising results in clinical trials (1-3,5-6). In addition to being used as a single agent, it is being studied as a possible combination therapy with other blocking antibodies such as anti-PD-L1 and anti-epidermal growth factor receptor (EGFR) (2,5,6).

References

1. Alfarra, H., Weir, J., Grieve, S., & Reiman, T. (2020). Targeting NK Cell Inhibitory Receptors for Precision Multiple Myeloma Immunotherapy. Frontiers in immunology, 11, 575609. https://doi.org/10.3389/fimmu.2020.575609

2. Creelan, B. C., & Antonia, S. J. (2019). The NKG2A immune checkpoint - a new direction in cancer immunotherapy. Nature reviews. Clinical oncology, 16(5), 277-278. https://doi.org/10.1038/s41571-019-0182-8

3. Zaghi, E., Calvi, M., Marcenaro, E., Mavilio, D., & Di Vito, C. (2019). Targeting NKG2A to elucidate natural killer cell ontogenesis and to develop novel immune-therapeutic strategies in cancer therapy. Journal of leukocyte biology, 105(6), 1243-1251. https://doi.org/10.1002/JLB.MR0718-300R

4. Uniprot (P26715)

5. Borst, L., van der Burg, S. H., & van Hall, T. (2020). The NKG2A-HLA-E Axis as a Novel Checkpoint in the Tumor Microenvironment. Clinical cancer research : an official journal of the American Association for Cancer Research, 26(21), 5549-5556. https://doi.org/10.1158/1078-0432.CCR-19-2095

6. Andre, P., Denis, C., Soulas, C., Bourbon-Caillet, C., Lopez, J., Arnoux, T., Blery, M., Bonnafous, C., Gauthier, L., Morel, A., Rossi, B., Remark, R., Breso, V., Bonnet, E., Habif, G., Guia, S., Lalanne, A. I., Hoffmann, C., Lantz, O., Fayette, J., ... Vivier, E. (2018). Anti-NKG2A mAb Is a Checkpoint Inhibitor that Promotes Anti-tumor Immunity by Unleashing Both T and NK Cells. Cell, 175(7), 1731-1743.e13. https://doi.org/10.1016/j.cell.2018.10.014

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB138
Species: Hu
Applications: CyTOF-reported, Flow
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-15184
Species: Hu, Rt
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, Simple Western
NBP2-14845
Species: Hu
Applications: IHC, IHC-P, WB
MAB24251
Species: Hu
Applications: CyTOF-ready, Flow, WB
247-ILB/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
AF2225
Species: Mu
Applications: AgAct, CyTOF-ready, Flow, IHC, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
MAB6549
Species: Hu
Applications: WB
MAB2238
Species: Hu
Applications: AgAct, CyTOF-reported, Flow
NBP1-74093
Species: Hu
Applications: WB

Publications for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093) (0)

There are no publications for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093) (0)

There are no reviews for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKG2A/CD159a/KLRC1 Products

Bioinformatics Tool for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Discover related pathways, diseases and genes to NKG2A/CD159a/KLRC1 Antibody (NBP1-74093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Discover more about diseases related to NKG2A/CD159a/KLRC1 Antibody (NBP1-74093).
 

Pathways for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

View related products by pathway.

PTMs for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Learn more about PTMs related to NKG2A/CD159a/KLRC1 Antibody (NBP1-74093).
 

Research Areas for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Find related products by research area.

Blogs on NKG2A/CD159a/KLRC1.

Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy
By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKG2A/CD159a/KLRC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRC1
Uniprot