NKG2A/CD159a/KLRC1 Antibody


Western Blot: NKG2A/CD159a/KLRC1 Antibody [NBP1-74093] - Lane: MCF7 cell Lysate, Antibody Titration :1 ug/ml, and Gel concentration :12%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NKG2A/CD159a/KLRC1 Antibody Summary

Synthetic peptides corresponding to the C terminal of KLRC1. Immunizing peptide sequence SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against KLRC1 and was validated on Western blot.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NKG2A/CD159a/KLRC1 Antibody

  • CD159 antigen-like family member A
  • CD159a antigen
  • CD159a
  • C-lectin type II protein
  • killer cell lectin-like receptor subfamily C, member 1
  • Klrc1
  • MGC13374
  • natural killer cell lectin
  • natural killer group protein 2
  • NK cell receptor A
  • NKG2
  • NKG2-1/B activating NK receptor
  • NKG2A
  • NKG2-A
  • NKG2-A/B type II integral membrane protein
  • NKG2-A/B-activating NK receptor
  • NKG2-A/NKG2-B type II integral membrane protein
  • NKG2AMGC59791
  • NKG2-B


Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, Block, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Mu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
Species: Hu
Applications: WB

Publications for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093) (0)

There are no publications for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093) (0)

There are no reviews for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NKG2A/CD159a/KLRC1 Products

Bioinformatics Tool for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Discover related pathways, diseases and genes to NKG2A/CD159a/KLRC1 Antibody (NBP1-74093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Discover more about diseases related to NKG2A/CD159a/KLRC1 Antibody (NBP1-74093).

Pathways for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

View related products by pathway.

PTMs for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Learn more about PTMs related to NKG2A/CD159a/KLRC1 Antibody (NBP1-74093).

Research Areas for NKG2A/CD159a/KLRC1 Antibody (NBP1-74093)

Find related products by research area.

Blogs on NKG2A/CD159a/KLRC1

There are no specific blogs for NKG2A/CD159a/KLRC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NKG2A/CD159a/KLRC1 Antibody and receive a gift card or discount.


Gene Symbol KLRC1