Njmu-R1 Antibody - BSA Free

Western Blot: Njmu-R1 Antibody [NBP1-82563] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Western Blot: Njmu-R1 Antibody [NBP1-82563] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse olfactory bulb shows positivity in dendrites and cell bodies of mitral cells.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse piriform cortex shows staining in neuronal cell bodies and dendrites.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse somatosensory cortex shows immunoreactivity in cell bodies and dendrites of pyramidal neurons.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse dentate gyrus shows staining in a subset of neurons in granular layer.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse medulla shows neuronal staining in the inferior olivary nucleus.

Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of human cerebral cortex shows dot-like positivity.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Njmu-R1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Njmu-R1 Antibody - BSA Free (NBP1-82563) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Njmu-R1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C17ORF75
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Njmu-R1 Protein (NBP1-82563PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Njmu-R1 Antibody - BSA Free

• chromosome 17 open reading frame 75
• NJMU-R1
• protein Njmu-R1
• spermatogenesis-related protein

Background

Njmu-R1 may have a role in spermatogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Njmu-R1 Antibody (NBP1-82563)(1)

Publication using NBP1-82563

• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: C17ORF75