Njmu-R1 Antibody

Images

 
Western Blot: Njmu-R1 Antibody [NBP1-82563] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: Njmu-R1 Antibody [NBP1-82563] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: Njmu-R1 Antibody [NBP1-82563] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse olfactory bulb shows positivity in dendrites and cell bodies of mitral cells.
Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse piriform cortex shows staining in neuronal cell bodies and dendrites.
Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse somatosensory cortex shows immunoreactivity in cell bodies and dendrites of pyramidal neurons.
Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse dentate gyrus shows staining in a subset of neurons in granular layer.
Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of mouse medulla shows neuronal staining in the inferior olivary nucleus.
Immunohistochemistry-Paraffin: Njmu-R1 Antibody [NBP1-82563] - Staining of human cerebral cortex shows dot-like positivity.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Njmu-R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVTI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C17ORF75
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Njmu-R1 Protein (NBP1-82563PEP)
Publications
Read Publication using NBP1-82563.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Njmu-R1 Antibody

  • chromosome 17 open reading frame 75
  • NJMU-R1
  • protein Njmu-R1
  • spermatogenesis-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
H00008877-M01
Species: Hu
Applications: WB, ELISA
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-31642
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84633
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14886
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1648
Species: Hu, Mu, Rt
Applications: WB, IHC
H00055743-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB
NBP2-20675
Species: Hu
Applications: WB, ICC/IF
NB200-199
Species: Hu, Mu
Applications: WB, IP, PLA

Publications for Njmu-R1 Antibody (NBP1-82563)(1)

Reviews for Njmu-R1 Antibody (NBP1-82563) (0)

There are no reviews for Njmu-R1 Antibody (NBP1-82563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Njmu-R1 Antibody (NBP1-82563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Njmu-R1 Products

Bioinformatics Tool for Njmu-R1 Antibody (NBP1-82563)

Discover related pathways, diseases and genes to Njmu-R1 Antibody (NBP1-82563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Njmu-R1 Antibody (NBP1-82563)

Discover more about diseases related to Njmu-R1 Antibody (NBP1-82563).

Blogs on Njmu-R1

There are no specific blogs for Njmu-R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Njmu-R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C17ORF75