GLTP Antibody - BSA Free

Western Blot: GLTP Antibody [NBP2-31642] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: GLTP Antibody [NBP2-31642] - Staining of human cell line PC-3 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GLTP Antibody [NBP2-31642] -Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: GLTP Antibody [NBP2-31642] -Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: GLTP Antibody [NBP2-31642] -Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GLTP Antibody [NBP2-31642] -Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLTP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLTP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GLTP Protein (NBP2-31642PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GLTP Antibody - BSA Free

• glycolipid transfer protein

Background

The GLTP gene codes for a cycloplasmic glycolipid transfer protein that is 209 amino acids long and is approximately 23 kDA. GLTP has been researched with its role in cholesterol, tuberculosis, venous insufficiency, and varicose veins. The GLTP gene frequently interacts with genes ELAVL1 and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLTP
• Uniprot:
  • Q9NZD2(Human)