PBK Antibody

Images

 
Western Blot: PBK Antibody [NBP1-84342] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PBK Antibody [NBP1-84342] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PBK Antibody [NBP1-84342] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.
Western Blot: PBK Antibody [NBP1-84342] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: PBK Antibody [NBP1-84342] - Staining of mouse brain shows positivity in rostral migratory stream.
Immunocytochemistry/ Immunofluorescence: PBK Antibody [NBP1-84342] - Staining of mouse medulla shows positivity in a subset of cells.
Immunocytochemistry/ Immunofluorescence: PBK Antibody [NBP1-84342] - Staining of mouse olfactory bulb shows immunoreactivity in a subset of neurons.
Immunocytochemistry/ Immunofluorescence: PBK Antibody [NBP1-84342] - Staining of mouse subventricular zone shows immunoreactivity in some cells in the rostral migratory stream.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PBK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PBK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PBK Protein (NBP1-84342PEP)
Publications
Read Publication using NBP1-84342.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PBK Antibody

  • Cancer/testis antigen 84
  • CT84MAPKK-like protein kinase
  • EC 2.7.12.2
  • FLJ14385
  • Nori-3PDZ-binding kinase
  • PDZ binding kinase
  • serine/threonine protein kinase
  • Spermatogenesis-related protein kinase
  • SPKT-LAK cell-originated protein kinase
  • TOPKlymphokine-activated killer T-cell-originated protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP2-05680
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P

Publications for PBK Antibody (NBP1-84342)(1)

Reviews for PBK Antibody (NBP1-84342) (0)

There are no reviews for PBK Antibody (NBP1-84342). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PBK Antibody (NBP1-84342) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBK Products

Bioinformatics Tool for PBK Antibody (NBP1-84342)

Discover related pathways, diseases and genes to PBK Antibody (NBP1-84342). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBK Antibody (NBP1-84342)

Discover more about diseases related to PBK Antibody (NBP1-84342).
 

Pathways for PBK Antibody (NBP1-84342)

View related products by pathway.

PTMs for PBK Antibody (NBP1-84342)

Learn more about PTMs related to PBK Antibody (NBP1-84342).

Blogs on PBK

There are no specific blogs for PBK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PBK