RBM28 Antibody

Images

 
Western Blot: RBM28 Antibody [NBP1-84633] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: RBM28 Antibody [NBP1-84633] - Staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: RBM28 Antibody [NBP1-84633] - Staining of human hippocampus shows distinct nucleolar positivity in neuronal cells.
Western Blot: RBM28 Antibody [NBP1-84633] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-464

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM28 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EHSKGCAFAQFMTQEAAQKCLLAASPENEAGGLKLDGRQLKVDLAVTRDEAAKLQTTKVKKPTGTRNLYLAREGLIRAGTKAAEGVSAADMAKRERFELLKHQKLKDQNIFVSRTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM28 Protein (NBP1-84633PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM28 Antibody

  • FLJ10377
  • RNA binding motif protein 28
  • RNA-binding motif protein 28,2810480G15Rik
  • RNA-binding protein 28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-230
Species: Hu
Applications: WB
NBP2-31642
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20675
Species: Hu
Applications: WB, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3757
Species: Hu
Applications: WB, ICC
NBP1-82563
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-14886
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut

Publications for RBM28 Antibody (NBP1-84633) (0)

There are no publications for RBM28 Antibody (NBP1-84633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM28 Antibody (NBP1-84633) (0)

There are no reviews for RBM28 Antibody (NBP1-84633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM28 Antibody (NBP1-84633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM28 Products

Bioinformatics Tool for RBM28 Antibody (NBP1-84633)

Discover related pathways, diseases and genes to RBM28 Antibody (NBP1-84633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM28 Antibody (NBP1-84633)

Discover more about diseases related to RBM28 Antibody (NBP1-84633).
 

Pathways for RBM28 Antibody (NBP1-84633)

View related products by pathway.

Blogs on RBM28

There are no specific blogs for RBM28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM28