NIPBL Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NIPBL Antibody [NBP1-85110] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Immunohistochemistry: NIPBL Antibody [NBP1-85110] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.
Immunohistochemistry: NIPBL Antibody [NBP1-85110] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NIPBL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIPBL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NIPBL Protein (NBP1-85110PEP)
Publications
Read Publication using
NBP1-85110 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25963978).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NIPBL Antibody

  • CDLS1
  • delangin
  • DKFZp434L1319
  • FLJ11203
  • FLJ12597
  • FLJ13354
  • FLJ13648
  • FLJ44854
  • IDN3-B
  • IDN3CDLS
  • Nipped-B homolog (Drosophila)
  • nipped-B-like protein
  • SCC2 homolog
  • Scc2
  • sister chromatid cohesion 2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-204
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56151
Species: Hu
Applications: ICC/IF
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NB100-87021
Species: Hu
Applications: WB, IP, PLA
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-87904
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for NIPBL Antibody (NBP1-85110)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NIPBL Antibody (NBP1-85110) (0)

There are no reviews for NIPBL Antibody (NBP1-85110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NIPBL Antibody (NBP1-85110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIPBL Products

Bioinformatics Tool for NIPBL Antibody (NBP1-85110)

Discover related pathways, diseases and genes to NIPBL Antibody (NBP1-85110). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIPBL Antibody (NBP1-85110)

Discover more about diseases related to NIPBL Antibody (NBP1-85110).
 

Pathways for NIPBL Antibody (NBP1-85110)

View related products by pathway.

PTMs for NIPBL Antibody (NBP1-85110)

Learn more about PTMs related to NIPBL Antibody (NBP1-85110).
 

Research Areas for NIPBL Antibody (NBP1-85110)

Find related products by research area.

Blogs on NIPBL

There are no specific blogs for NIPBL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIPBL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIPBL