NIPA Antibody

Images

 
Independent Antibodies: Western Blot: NIPA Antibody [NBP1-82565] - Analysis using Anti-ZC3HC1 antibody NBP1-82565 (A) shows similar pattern to independent antibody NBP1-82564 (B).
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82565] - Staining of human cerebellum, placenta, skin and testis using Anti-NIPA antibody NBP1-82565 (A) shows similar protein distribution across tissues to ...read more
Western Blot: NIPA Antibody [NBP1-82565] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82565] - Staining of human gall bladder shows nuclear and nuclear membrane positivity in glandular cells.
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82565] - Staining of human kidney.
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82565] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82565] - Staining of human colon.
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82565] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

NIPA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3HC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NIPA Protein (NBP1-82565PEP)
Publications
Read Publication using NBP1-82565.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NIPA Antibody

  • C3HC type 1
  • FBXO50
  • zinc finger, C3HC-type containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-26116
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP2-15596
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-81748
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82565
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NIPA Antibody (NBP1-82565)(1)

Reviews for NIPA Antibody (NBP1-82565) (0)

There are no reviews for NIPA Antibody (NBP1-82565). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIPA Antibody (NBP1-82565) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NIPA Products

Bioinformatics Tool for NIPA Antibody (NBP1-82565)

Discover related pathways, diseases and genes to NIPA Antibody (NBP1-82565). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIPA Antibody (NBP1-82565)

Discover more about diseases related to NIPA Antibody (NBP1-82565).
 

Pathways for NIPA Antibody (NBP1-82565)

View related products by pathway.

PTMs for NIPA Antibody (NBP1-82565)

Learn more about PTMs related to NIPA Antibody (NBP1-82565).

Blogs on NIPA

There are no specific blogs for NIPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3HC1