ZDHHC17 Antibody

Images

 
Western Blot: ZDHHC17 Antibody [NBP1-81748] - Analysis in control (vector only transfected HEK293T lysate) and ZDHHC17 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ZDHHC17 Antibody [NBP1-81748] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZDHHC17 Antibody [NBP1-81748] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ZDHHC17 Antibody [NBP1-81748] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: ZDHHC17 Antibody [NBP1-81748] - Staining of human cerebral cortex shows moderate cytoplasmic and membranous positivity in neurons.
Immunohistochemistry-Paraffin: ZDHHC17 Antibody [NBP1-81748] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ZDHHC17 Antibody [NBP1-81748] - Staining of human testis shows moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZDHHC17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVR
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZDHHC17 Protein (NBP1-81748PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZDHHC17 Antibody

  • DHHC-17
  • EC 2.3.1
  • EC 2.3.1.-
  • HIP14HIP-14
  • huntingtin interacting protein 14
  • huntingtin interacting protein 3
  • Huntingtin interacting protein H
  • Huntingtin yeast partner H
  • Huntingtin-interacting protein 14
  • Huntingtin-interacting protein 3
  • Huntingtin-interacting protein H
  • HYPHHIP-3
  • KIAA0946HIP3
  • palmitoyltransferase ZDHHC17
  • Putative MAPK-activating protein PM11
  • Putative NF-kappa-B-activating protein 205
  • Zinc finger DHHC domain-containing protein 17
  • zinc finger, DHHC domain containing 17
  • zinc finger, DHHC-type containing 17

Background

ZDHHC17 / HIP14 is a neuronal palmitoyl transferase. Palmitoylation is critical for trafficking and function of signaling molecules, neurotransmitter receptors, and synaptic scaffolding proteins in neurons. ZDHHC17 also causes cellular transformation. It has been shown that mRNA encoding ZDHHC17 is up-regulated in a number of types of human tumors, thus ZDHHC17 and other PATs (palmitoyl acyltransferases) are potential targets for new anticancer drugs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-51920
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-33284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00051304-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-87974
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-87770
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-82652
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82564
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NBP3-12600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF1568
Species: Mu
Applications: WB
NBP1-81748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZDHHC17 Antibody (NBP1-81748) (0)

There are no publications for ZDHHC17 Antibody (NBP1-81748).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC17 Antibody (NBP1-81748) (0)

There are no reviews for ZDHHC17 Antibody (NBP1-81748). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZDHHC17 Antibody (NBP1-81748) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC17 Products

Bioinformatics Tool for ZDHHC17 Antibody (NBP1-81748)

Discover related pathways, diseases and genes to ZDHHC17 Antibody (NBP1-81748). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC17 Antibody (NBP1-81748)

Discover more about diseases related to ZDHHC17 Antibody (NBP1-81748).
 

Pathways for ZDHHC17 Antibody (NBP1-81748)

View related products by pathway.

PTMs for ZDHHC17 Antibody (NBP1-81748)

Learn more about PTMs related to ZDHHC17 Antibody (NBP1-81748).
 

Research Areas for ZDHHC17 Antibody (NBP1-81748)

Find related products by research area.

Blogs on ZDHHC17

There are no specific blogs for ZDHHC17, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZDHHC17