NGX6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NGX6 Antibody [NBP2-57356] - Staining of human cell line PC-3 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NGX6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVA
Specificity
Specificity of human NGX6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM8B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NGX6 Recombinant Protein Antigen (NBP2-57356PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NGX6 Antibody

  • C9orf127
  • chromosome 9 open reading frame 127
  • NAG-5
  • nasopharyngeal carcinoma expressed 6
  • nasopharyngeal carcinoma related protein
  • Nasopharyngeal carcinoma-associated gene 6 protein
  • NGX6MGC120460
  • Protein NAG-5
  • Protein NGX6
  • RP11-112J3.10
  • transmembrane protein 8B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
AF4274
Species: Mu
Applications: WB, IHC
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-64943
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NGX6 Antibody (NBP2-57356) (0)

There are no publications for NGX6 Antibody (NBP2-57356).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGX6 Antibody (NBP2-57356) (0)

There are no reviews for NGX6 Antibody (NBP2-57356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NGX6 Antibody (NBP2-57356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NGX6 Antibody (NBP2-57356)

Discover related pathways, diseases and genes to NGX6 Antibody (NBP2-57356). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGX6 Antibody (NBP2-57356)

Discover more about diseases related to NGX6 Antibody (NBP2-57356).
 

Pathways for NGX6 Antibody (NBP2-57356)

View related products by pathway.

PTMs for NGX6 Antibody (NBP2-57356)

Learn more about PTMs related to NGX6 Antibody (NBP2-57356).
 

Research Areas for NGX6 Antibody (NBP2-57356)

Find related products by research area.

Blogs on NGX6

There are no specific blogs for NGX6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NGX6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM8B