NFYA Antibody - BSA Free

Western Blot: NFYA Antibody [NBP2-87907] - WB Suggested Anti-NFYA Antibody Titration: 5.0-8.0ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysateNFYA is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Immunohistochemistry: NFYA Antibody [NBP2-87907] - Human Liver

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

NFYA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFYA Antibody - BSA Free (NBP2-87907) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human NFYA. Peptide sequence: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFYA
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NFYA Antibody - BSA Free

• CAAT box DNA-binding protein subunit A
• CBF-A
• CBF-B
• CCAAT-binding transcription factor subunit B
• FLJ11236
• HAP2 CCAAT-binding protein
• HAP2
• NF-YACAAT-box DNA binding protein subunit A
• Nuclear transcription factor Y subunit A
• nuclear transcription factor Y subunit alpha
• nuclear transcription factor Y, alpha
• Transcription factor NF-Y, A subunit

Background

The Y box is a CCAAT box which is bound by the heteromeric DNA binding protein, NFY (also known as CBF and CP1). Unlike the transcription factors C/EBP and CTF/NF1 which also bind CCAAT like sequences, NFY exhibits a strict binding requirement for this pentanucleotide sequence. Binding sites for this factor have been described for nearly 30% of all eukaryotic genes. Y/CCAAT sequences were frequently observed in the promoter proximal sequences. NF-Y is composed of 3 separate subunits (A,B and C) each of which is required for DNA binding. Each subunit has remained highly conserved throughout evolution. In fact, homologous yeast subunits can substitute for mammalian NF-Y in DNA-binding assays. The conserved core sequences of NF-YB and NF-YC contain a 70 aa region similar to the histone fold motif of nucleosomes H2A and H2B. The unique structure and evolutionary conservation of this transcription factor suggests that it plays a fundamental role in the readout of eukaryotic genetic information.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFYA