NFkB p100/p52 Antibody - BSA Free

Western Blot: NFkB p100/p52 Antibody [NBP2-95200] - Analysis of extracts of various cell lines, using NFkB p100/p52 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: NFkB p100/p52 Antibody [NBP2-95200] - Analysis of U2OS cells using NFkB p100/p52 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP2-95200] - Rat brain using NF-kB2 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP2-95200] - Human breast using NF-KB2 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP2-95200] - Mouse testis using NF-kB2 antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFkB p100/p52 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFkB p100/p52 Antibody - BSA Free (NBP2-95200) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 690-899 of human NFkB p100/p52 (NP_002493.3). AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFKB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NFkB p100/p52 Antibody - BSA Free

• DNA-binding factor KBF2
• H2TF1
• Lymphocyte translocation chromosome 10 protein
• Lyt10
• LYT10LYT-10
• nuclear factor NF-kappa-B p100 subunit
• nuclear factor of kappa light chain gene enhancer in B-cells 2
• nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
• Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
• Oncogene Lyt-10
• p52

Background

The NFkappaB transcription factor was originally identified as a protein complex consisting of a DNA binding subunit and an associated protein. The DNA binding subunit is functionally related to c-Rel p75 and Rel B p68. The p50 subunit was initially believed to be a functionally unique protein derived from the amino-terminus of a precursor designated p105. A cDNA has been isolated that encodes an alternative DNA binding subunit of NFkappaB. It is synthesized as a protein that is expressed in a variety of cell types and, like p105, undergoes cleavage to generate its NFkappaB subunit, in this case a protein designated p52 (previously referred to as p49). In contrast to p50 derived from p105, p52 acts in synergy with p65 to stimulate the HIV enhancer in transiently transfected Jurkat cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFKB2