NFATC2/NFAT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NFATC2/NFAT1 Antibody [NBP1-82583] - Analysis in human lymph node and skeletal muscle tissues. Corresponding NFATC2 RNA-seq data are presented for the same tissues.

Western Blot: NFATC2/NFAT1 Antibody [NBP1-82583] - Analysis in human cell line CACO-2.

Immunocytochemistry/Immunofluorescence: NFATC2/NFAT1 Antibody [NBP1-82583] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NFATC2/NFAT1 Antibody [NBP1-82583] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: NFATC2/NFAT1 Antibody [NBP1-82583] - Staining of human lymph node shows positivity in lymphoid cells.

Immunohistochemistry-Paraffin: NFATC2/NFAT1 Antibody [NBP1-82583] - Staining of human duodenum shows positivity in lymphoid cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFATC2/NFAT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFATC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25719243). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NFATC2/NFAT1 Protein (NBP1-82583PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%). Mouse reactivity reported in scientific literature (PMID: 25719243).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NFATC2/NFAT1 Antibody - BSA Free

• NFAT pre-existing subunit
• NFAT transcription complex, preexisting component
• NFAT1
• NFAT1nuclear factor of activated T-cells, cytoplasmic 2
• NFATC2
• NF-ATc2
• NFATP
• NF-ATp
• NFATPnuclear factor of activated T-cells, preexisting component
• nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
• preexisting nuclear factor of activated T-cells 2
• T cell transcription factor NFAT1
• T-cell transcription factor NFAT1

Background

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1, NFAT2, NFAT3, and NFAT4. These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NFATC2/NFAT1 Antibody (NBP1-82583)(2)

Publications using NBP1-82583

• Scanlon CS, Banerjee R, Inglehart RC et al. Galanin modulates the neural niche to favour perineural invasion in head and neck cancer. Nat Commun 2015-04-28 [PMID: 25917569] (WB, Human)
• Tran Quang C, Leboucher S, Passaro D et al. The calcineurin/NFAT pathway is activated in diagnostic breast cancer cases and is essential to survival and metastasis of mammary cancer cells. Cell Death Dis 2015-02-26 [PMID: 25719243] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: NFATC2