NFATC2/NFAT1 Antibody

Images

 
Immunohistochemistry: NFATC2/NFAT1 Antibody [NBP1-82582] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFATC2/NFAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFATC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
NFATC2/NFAT1 Protein (NBP1-82582PEP)
Publications
Read Publication using
NBP1-82582 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%). Human reactivity reported in scientific literature (PMID: 26387540).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFATC2/NFAT1 Antibody

  • NFAT pre-existing subunit
  • NFAT transcription complex, preexisting component
  • NFAT1
  • NFAT1nuclear factor of activated T-cells, cytoplasmic 2
  • NFATC2
  • NF-ATc2
  • NFATP
  • NF-ATp
  • NFATPnuclear factor of activated T-cells, preexisting component
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
  • preexisting nuclear factor of activated T-cells 2
  • T cell transcription factor NFAT1
  • T-cell transcription factor NFAT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF5834
Species: Hu, Mu, Rt
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB342
Species: Hu
Applications: WB, AgAct
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82582
Species: Hu
Applications: IHC, IHC-P

Publications for NFATC2/NFAT1 Antibody (NBP1-82582)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NFATC2/NFAT1 Antibody (NBP1-82582) (0)

There are no reviews for NFATC2/NFAT1 Antibody (NBP1-82582). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NFATC2/NFAT1 Antibody (NBP1-82582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFATC2/NFAT1 Products

Bioinformatics Tool for NFATC2/NFAT1 Antibody (NBP1-82582)

Discover related pathways, diseases and genes to NFATC2/NFAT1 Antibody (NBP1-82582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFATC2/NFAT1 Antibody (NBP1-82582)

Discover more about diseases related to NFATC2/NFAT1 Antibody (NBP1-82582).
 

Pathways for NFATC2/NFAT1 Antibody (NBP1-82582)

View related products by pathway.

PTMs for NFATC2/NFAT1 Antibody (NBP1-82582)

Learn more about PTMs related to NFATC2/NFAT1 Antibody (NBP1-82582).
 

Research Areas for NFATC2/NFAT1 Antibody (NBP1-82582)

Find related products by research area.

Blogs on NFATC2/NFAT1

There are no specific blogs for NFATC2/NFAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFATC2/NFAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFATC2
Entrez