NFATC2/NFAT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NFATC2/NFAT1 Antibody [NBP1-82582] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: NFATC2/NFAT1 Antibody [NBP1-82582] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: NFATC2/NFAT1 Antibody [NBP1-82582] - Staining in human lymph node and cerebral cortex tissues using anti-NFATC2 antibody. Corresponding NFATC2 RNA-seq data are presented for the same tissues.

ChIP-Exo-Seq composite graph for Anti-NFATC2 (NBP1-82582) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFATC2/NFAT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFATC2/NFAT1 Antibody - BSA Free (NBP1-82582) is a polyclonal antibody validated for use in IHC. Anti-NFATC2/NFAT1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFATC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 26387540). For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
• Control Peptide:

  NFATC2/NFAT1 Protein (NBP1-82582PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%). Human reactivity reported in scientific literature (PMID: 26387540).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NFATC2/NFAT1 Antibody - BSA Free

• NFAT pre-existing subunit
• NFAT transcription complex, preexisting component
• NFAT1
• NFAT1nuclear factor of activated T-cells, cytoplasmic 2
• NFATC2
• NF-ATc2
• NFATP
• NF-ATp
• NFATPnuclear factor of activated T-cells, preexisting component
• nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
• preexisting nuclear factor of activated T-cells 2
• T cell transcription factor NFAT1
• T-cell transcription factor NFAT1

Background

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1, NFAT2, NFAT3, and NFAT4. These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NFATC2/NFAT1 Antibody (NBP1-82582)(1)

Publication using NBP1-82582

• V Perotti, P Baldassari, A Molla et al. NFATc2 is an intrinsic regulator of melanoma dedifferentiation. Oncogene 2015-09-21 [PMID: 26387540] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: NFATC2